Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4k35 Olfactory Receptor

Gene Symbol Or4k35
Organism Rat
Family 4
Subfamily k
Pseudo No
Location chr3:102483609-102484517 (-)
Aliases Olr750

Sequence information


Nucleotide sequence

ATGGAGAAAACAAACCAGTCTGAAGGGTCTGAATTCATTATTCTTGGTCTTTGTGACTCT
TGGGAGCTCCAAGCCTTTTTCTTAGTGATATTTTCTTCACTTTATTTAACCACCATTTTG
GGTAACATTTTTATTGTACTCATAATCATCACAGACCTTCGTCTCCATTCTCCTATGTAC
TTTCTGTTGGCCAACCTCTCATTCATTGACTTCTGCCTTTCTTCAGTCACTACACCTAAG
ATGATTATAGATTTCCTCAAGGAAAAGAAGACGATCTCCTTTGGAGGGTGCATGTGTCAG
ATTTTCTTTGGTCACTTCTTCGGAGGGGGTGAGATGGTACTGCTTGTATCAATGGCTTAT
GACCGTTATGTAGCCATTTGTAAGCCACTCCATTACTCTAGCATCATGAACAGACATATG
TGCATTGGATTAGTGGTGGCATCATGGATCATTGGCTTTGTGCATTCAATCAGCCAACTG
GTTATAATTGTAAATCTTCCCTTCTGTGGATCCAGAGTTTTAGACAGTTTTTTCTGCGAT
ATTCCATTGGTCATCAAGCTAGCCTGCTTGGACATCTATGTTCTAGAAATTTTGATAAAT
GCTGACAGCGGGGTGCTAGCAGCCGTATGCTTCATTCTGTTGCTGATGTCCTACTCCCAT
ATTCTGACTACTGTCTGCCTTCATTCTAAGGATGGGGCATCCAAAGCTCTCTCTACTTGT
ACTGCCCACATCATAGTGGTAGTATTATTTTTTGGGCCCTGCATCTTCATCTATCTGTGG
CCAGTCAGCATAACATGGGTGGACAAATTCCTTGCTGTGTTTTATGCAGTTATCACACCT
CTCCTGAATCCAGCCATTTATACTTTAAGAAACAAAGAGATTAAAAATGCTATGAAGAGG
TTACAGTGC


Conceptual translation

MEKTNQSEGSEFIILGLCDSWELQAFFLVIFSSLYLTTILGNIFIVLIIITDLRLHSPMY
FLLANLSFIDFCLSSVTTPKMIIDFLKEKKTISFGGCMCQIFFGHFFGGGEMVLLVSMAY
DRYVAICKPLHYSSIMNRHMCIGLVVASWIIGFVHSISQLVIIVNLPFCGSRVLDSFFCD
IPLVIKLACLDIYVLEILINADSGVLAAVCFILLLMSYSHILTTVCLHSKDGASKALSTC
TAHIIVVVLFFGPCIFIYLWPVSITWVDKFLAVFYAVITPLLNPAIYTLRNKEIKNAMKR
LQC