Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k36 Olfactory Receptor

Gene Symbol Or4k36
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111315481-111316395 (+)
Aliases Olfr1280, RP24-383G18.2, MOR248-1

Sequence information


Nucleotide sequence

ATGGAAGAAGCAAACCAGACTGTGGTGTCTGAGTTTATTTTTCAGGGACTTTGTGCTTCA
AAGGAACTACAGATCTTGCTCCTGCTGCCATTTTCCACCCTCTACATGATGACTGTGGTA
GGCAACCTCTTTGTAGTGATATTGATCATCATTGATCATCATCTCCATTCTCCCATGTAC
TTTCTGTTAGCTAATCTATCATTTATTGACTTCTGCCTTTCCTCAGTTACCACCCCCAAA
CTGATAACTGACCTCCTAAAAGATAACAAAACCATTTCCTTTGGGGGCTGCATGAGCCAG
ATCCTCTGTGTGCACTTCTTTGGAGGAGGTGAGATGGTGCTTCTTGTAACAATGGCCTAT
GACCGGTATGTGGCCATCTGCAGGCCACTCCACTACAGCAGCATCATGGACAGACAGAAG
TGCATCTGGCTCGTTGTGATATCATGGACCATTGGCTTTATACATGCCATGAGTCAACTG
ATACTGATTTTGGATCTGCCTTTCTGTGGACCTAGAGTGATAGACAGCTTTTTCTGTGAT
ATTCCTTTAGTGATGAAATTAGCCTGCATGAATACTGATACTCTGGGAATAGTGATAAAT
GCTGATAGTGGTGTCTTAGCAACAACTTGTTTCATACTTTTATTGATCTCTTACACTTAT
ATTTTACTAACTGTTCAGCTTCACTCTAAAGATGGCTCATCAAAGGCGCTCTCTACATGT
ACTTCTCATATTATAGTGGTTGTGCTGTTCTTTGGACCCTGCATTTTCATCTATCTGTGG
CCAGTCAGCATCACTTGGGTGGACAAGTTTCTAGCTGTGTTTTACACAGTCATCACACCT
CTCCTGAATCCAGCAATCTATACACTGAGGAATAAAGATATTAAAAATGCCATAAAGAAG
CTGAAAAATCACATG


Conceptual translation

MEEANQTVVSEFIFQGLCASKELQILLLLPFSTLYMMTVVGNLFVVILIIIDHHLHSPMY
FLLANLSFIDFCLSSVTTPKLITDLLKDNKTISFGGCMSQILCVHFFGGGEMVLLVTMAY
DRYVAICRPLHYSSIMDRQKCIWLVVISWTIGFIHAMSQLILILDLPFCGPRVIDSFFCD
IPLVMKLACMNTDTLGIVINADSGVLATTCFILLLISYTYILLTVQLHSKDGSSKALSTC
TSHIIVVVLFFGPCIFIYLWPVSITWVDKFLAVFYTVITPLLNPAIYTLRNKDIKNAIKK
LKNHM