Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4k36 Olfactory Receptor

Gene Symbol Or4k36
Organism Rat
Family 4
Subfamily k
Pseudo No
Location chr3:102553317-102554231 (+)
Aliases Olr753

Sequence information


Nucleotide sequence

ATGGAAGAAGCAAACCAGACTGTGGTGTCTGAGTTTATTTTTCAGGGACTTTGTGCTTCA
AAAGAACTACAGATCTTCCTCTTACTGCCATTTTCTACTCTCTATCTGTTGACTGTGGTA
GGCAACCTCTTTGTTGTGATATTGATCATCATTGATCATCATCTCCATTCTCCCATGTAC
TTTCTGTTAGCTAATCTATCATTTATTGACTTCTGCCTTTCCTCAGTAACCACCCCCAAA
CTGACAACTGACCTCCTAAAAGATAATAAAACCATTTCCTTTGGGGGCTGCATGAGCCAG
ATCCTCTGTGTTCACTTCTTTGGAGGAGGTGAGATGGTACTTCTTGTAACAATGGCCTAT
GACCGGTATGTGGCCATCTGCAGGCCACTACACTACAGCAGCATCATGGACAGACAGAAG
TGCATCTGGCTTGTTTTGATATCATGGATCATTGGCTTTATACATGCCATGAGTCAACTG
ATACTGATTTTGGAACTACCTTTCTGTGGACCTAAAGTGATAGACAGCTTTTTCTGTGAT
ATTCCTTTGGTGATGAAATTAGCCTGCATGAATACTGATACTCTGGGAATAGTGATAAAT
GCTGACAGTGGTGTCTTAGCAACAACTTGTTTCATCCTTTTGCTCATCTCTTACACTTAT
ATTTTACTAACTGTTCAGCTTCACTCTAAAGATGGCTCATCAAAGGCACTATCTACATGT
ACTTCCCATGTCATAGTGGTTGTGCTATTCTTTGGACCCTGCATTTTCATCTATCTGTGG
CCAGTTAGCATCACTTGGGTGGACAAGTTTCTTGCTGTATTTTACACAGTCGTCACACCT
CTCCTGAATCCAGCCATCTATACATTGAGAAATAAAGATATTAAGAATGCCATAAAGAAG
TTGATGAATCACATG


Conceptual translation

MEEANQTVVSEFIFQGLCASKELQIFLLLPFSTLYLLTVVGNLFVVILIIIDHHLHSPMY
FLLANLSFIDFCLSSVTTPKLTTDLLKDNKTISFGGCMSQILCVHFFGGGEMVLLVTMAY
DRYVAICRPLHYSSIMDRQKCIWLVLISWIIGFIHAMSQLILILELPFCGPKVIDSFFCD
IPLVMKLACMNTDTLGIVINADSGVLATTCFILLLISYTYILLTVQLHSKDGSSKALSTC
TSHVIVVVLFFGPCIFIYLWPVSITWVDKFLAVFYTVVTPLLNPAIYTLRNKDIKNAIKK
LMNHM