Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4k37 Olfactory Receptor

Gene Symbol Or4k37
Organism Rat
Family 4
Subfamily k
Pseudo No
Location chr3:102579446-102580360 (+)
Aliases Olr754

Sequence information


Nucleotide sequence

ATGGAAGACTCTAACCATACTGGGGTTTCTCAGTTTATTTTTCAGGGACTTTGTACCACA
AGGGAACTTGAGATCTTCCTCTTACTACCGTTTTCCACCCTCTACCTGATGACAATAGTA
GGCAACCTCTTTGTAGTGATATTGATAATCATTGATCATCATCTCCATTCTCCCATGTAC
TTTCTGTTAGCTAATCTCTCATTTGTAGATTTCTGCCTTTCTTCAGTAAATACACCCAAA
CTGGCCATAGATCTACTAAAAGAAAATAAAACCATTTCCTTTGGGGGCTGCATGAGTCAG
ATCCTCTGTGTACATTTCTTTGGAGGAAGCGAGATGGTACTTCTTGTAACAATGGCCTAT
GACCGATGTGTGGCCATCTGCAGACCACTCCATTACAGCACCATCATGGACAGACAGAAG
TGCATCTGGCTCGTTGTGATATCATGGATTATTGGATTTGTACATGCCATTAGTCAGATT
CTCTTGATTTTGGATCTACCTTTCTGTGGACCTAGAGTGATAGACAGCTTTTTCTGTGAT
ATTCCTTTGGTGATGAAATTAGCCTGCGTGAATACTGATACTCTGGAAATCCTAATAAAT
GCTGACAGTGGCATTTTAGCAACAACTTGTTTCATTCTCTTGCTCATATCCTATACTTAT
ATTCTATTAACTGTTAAACTTCATTCTAAAGATGGCTCATCAAAGGCACTATCCACATGT
ACATCCCATATCATAGTGGTTGTGCTATTCTTTGGGCCCATCATTTTTATCTATCTTTGG
CCAGTCAACATCACTTGGGTAGACAAGTTTCTAGCTGTGTTTTACACAGTCATTACACCT
TTCCTGAATCCAGCCATCTATACACTAAGAAATAAAGATATTAAGAATGCCATAAGGAAG
CTAATAAATCACATG


Conceptual translation

MEDSNHTGVSQFIFQGLCTTRELEIFLLLPFSTLYLMTIVGNLFVVILIIIDHHLHSPMY
FLLANLSFVDFCLSSVNTPKLAIDLLKENKTISFGGCMSQILCVHFFGGSEMVLLVTMAY
DRCVAICRPLHYSTIMDRQKCIWLVVISWIIGFVHAISQILLILDLPFCGPRVIDSFFCD
IPLVMKLACVNTDTLEILINADSGILATTCFILLLISYTYILLTVKLHSKDGSSKALSTC
TSHIIVVVLFFGPIIFIYLWPVNITWVDKFLAVFYTVITPFLNPAIYTLRNKDIKNAIRK
LINHM