Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k39-ps Olfactory Receptor

Gene Symbol Or4k39-ps
Organism Mouse
Family 4
Subfamily k
Pseudo Yes
Location chr2:111408504-111409309 (+)
Aliases Olfr1285-ps1

Sequence information


Nucleotide sequence

ATGACTTTGGTAGATAACCTCTTTGTAGTGATATTGATCATCACTGATCATCATTTCAAT
TCTCCCATGTACTTTCTGTCAGCTAATCTATCATTTGTTGACTTCTACCTTTCCTCAGTA
AATACACCCAAACTGACCATAGATCTCCTAAAAGAAAATAAAACAATTTCCTTTGGGGGC
TGCATGAGCCAGATCCTCTGTGTGCATTTCTTTGGAGGAAGTGAGATGGTGCTTCTTGTA
ACAATGGCCTATGACCAGTATGTGGCCATCTGCAGGCCACTCCACTGCAGCGGCAGCATG
GACAGACAGAAGTGCATCTGGCTCGTTGTGATATCATGGATTGTTGGATTTGTGCATGCC
ATTAGTCAGTTGCTCTTGATTTTGGATCTACCTTTCTGTGGACCTAGAGTGATAGACAGC
TTTTTCTGTAATATTCCTTTGGTGATGAAATTAGCCTGCATGAATACTGATACTCTGGGA
ATCCTAATAAATGCTGACAGTGGCATTTTAGCAACGTATTCTTTCACTCTCTTACTGATA
TCTTATACTTATATTCTATTAACTGTTCAACATCACTCTAAAGATGGCTCATTAAAAGCA
CTATCCACATGCACGTCCCATATCATAGTGGTTCTGCTGTTCTTTGGGCCCATCATTTTT
ATCTATCTGTGGCCAATAAACATCACTTGGGTGGACAAGTTTCTTGCTGTGTTTTATACA
GTCATCACACCTCTCCTGAATCCAGCAATCTATACACTGAGAAATAAAGATATTAAAAAT
GCTATAAAAAACTGACAAATCACATG


Conceptual translation

MTLVDNLFVVILIITDHHFNSPMYFLSANLSFVDFYLSSVNTPKLTIDLLKENKTISFGG
CMSQILCVHFFGGSEMVLLVTMAYDQYVAICRPLHCSGSMDRQKCIWLVVISWIVGFVHA
ISQLLLILDLPFCGPRVIDSFFCNIPLVMKLACMNTDTLGILINADSGILATYSFTLLLI
SYTYILLTVQHHSKDGSLKALSTCTSHIIVVLLFFGPIIFIYLWPINITWVDKFLAVFYT
VITPLLNPAIYTLRNKDIK/CYKKLTNHM