Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k40 Olfactory Receptor

Gene Symbol Or4k40
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111420035-111420949 (-)
Aliases Olfr1286, GA_x5J8B7TU5VU-1563-1372, GA_x6K02T2Q125-7247

Sequence information


Nucleotide sequence

ATGGAAGACTCTAATCATACTGTGGCTTCTGAGTTTATTTTTCAGGGACTGTGTTCCTCA
AGGCAACTTGAGATCTTCCTCTTACTGCCATTTTCCATCCTCTACCTGATGGCTGTGGTA
GGCAACCTGTTTGTTGTGATATTGATCATCATTGATCATCATCTCCATTCTCCCATGTAC
TTCTTGTTAGCTAATCTATCATTTATTGACTTCTGCCTTTGCTCAGTAACCACCCCCAAA
CTGACTATAGATCTCCTAAAAGAAAATAAAACCATTTCCTTTGTAGGGTGTATGAGCCAG
ATCGTCTGTGTGCACTTCTTTGCAGGAGGTGAGATGGTACTTCTTGTAACAATGGCCTAT
GACCGGTATGTGGCCATCTGCAGGCCACTCCACTACAGCAGCATCATGGACAGACAGAAG
TGCATCTGGTTCCTTGTGATTCCATGGATTGTTGGATTTGTGCATGCCATTAGTCAGATG
CTCTTGATTTTGGATCTACCTTTCTGTGGACCTAGAGTGATAGACAGCTTTTTCTGTGAT
ATTCCTTTGGTGATGAAATTAGCCTGCATGAATACTGATACTCTGGAAATCCTAATAAAT
GCTGACAGTGGCATTTTAGCAACAACTTGTTTCATCCTCTTGCTTGTATCTTATACTTAC
ATTCTATTAACTGTTCAACATCGCTCTAAAGATGGCTCATCAAAAGCCCTATCTACATGC
ACATCCCATATCATAGTGGTTCTGCTGTTCTTTGGGCCCATCATTTTCATCTATCTGTGG
CCAGTTAGCATCACCTGGGTTGACAAGTTTCTGGCTGTATTTTACTCAGTCATCACACCT
CTCCTGAATCCAGCCATCTACACACTGAGAAATAAAGATATTAAAAATGCCATAAAGAAG
CTGATAAGTCACAAA


Conceptual translation

MEDSNHTVASEFIFQGLCSSRQLEIFLLLPFSILYLMAVVGNLFVVILIIIDHHLHSPMY
FLLANLSFIDFCLCSVTTPKLTIDLLKENKTISFVGCMSQIVCVHFFAGGEMVLLVTMAY
DRYVAICRPLHYSSIMDRQKCIWFLVIPWIVGFVHAISQMLLILDLPFCGPRVIDSFFCD
IPLVMKLACMNTDTLEILINADSGILATTCFILLLVSYTYILLTVQHRSKDGSSKALSTC
TSHIIVVLLFFGPIIFIYLWPVSITWVDKFLAVFYSVITPLLNPAIYTLRNKDIKNAIKK
LISHK