Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k41 Olfactory Receptor

Gene Symbol Or4k41
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111449142-111450056 (+)
Aliases Olfr1287, RP23-336F11.5, MOR248-15

Sequence information


Nucleotide sequence

ATGGAAGAAACAAACCAGACTGTGGTCTCTGAGTTTATTTTTCAGGGAATTTGTGCTTCA
AAGGAACTACAGCTCTTCCTCCTGCTGCCATTTTCCATCCTCTATCTAATGGCTGTGGTA
GGCAACCTCTTTGTTGTGATATTGATCATCATTGATCATCATCTCCATTCTACCATGTAC
TTTCTGTTAGCTAATCTATCATTTATTGACTTCTGCCTTTCCTCAGTTACCACCCCCAAA
CTGATAACTGACCTCCTAAAAGATAACAAAACCATTTCCTTTGGGGGCTGCATGAGCCAG
ATCCTCTGTGTGTACTTCTTTGGAGGAAGTGAGATGGTGCTTCTTGTAACAATGGCCTAT
GACCGGTATGTGGCCATCTGCAGGCCACTCCACTACAGCAGCATCATGGGCAGACAGAAG
TGCATCTGGCTTGTTGTGATATCATGGACCATTGGCTTTATACATGCCATGAGTCAACTG
ATACTGATTTTGGATCTGCCTTTCTGTGGACCTAGAGTGATAGACAGCTTTTTCTGTGAT
ATTTCTTTGGTGATGAAATTAGCCTGCATGAATACTGATACTCTGGAAATTCTAATAAAT
GCTGACAGTGGTGTTTTGGCAACAACTTGTTTCATCCTCTTACTGATATCTTATACTAAC
ATTCTATTAACTGTTCAACTTCACTCTAAAGATGGTTCATCAAAGGCATTATCTACATGC
ACATCCCATATCATAGTGGTTTTGCTGTTCTTTGGGCCAGTCATTTTCATCTATCTGTGT
CCAGTTAGCATCACCTGGGTTGACAACTTTCTTGCCGTATTTTACTCAGTCATCACACCT
CTCCTTAATCCAGCCATCTACACACTGAGAAACAAAGATATTAAAAATGCCATAAAGAAG
CTGATAAACCACTTG


Conceptual translation

MEETNQTVVSEFIFQGICASKELQLFLLLPFSILYLMAVVGNLFVVILIIIDHHLHSTMY
FLLANLSFIDFCLSSVTTPKLITDLLKDNKTISFGGCMSQILCVYFFGGSEMVLLVTMAY
DRYVAICRPLHYSSIMGRQKCIWLVVISWTIGFIHAMSQLILILDLPFCGPRVIDSFFCD
ISLVMKLACMNTDTLEILINADSGVLATTCFILLLISYTNILLTVQLHSKDGSSKALSTC
TSHIIVVLLFFGPVIFIYLCPVSITWVDNFLAVFYSVITPLLNPAIYTLRNKDIKNAIKK
LINHL