Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4k42-ps Olfactory Receptor

Gene Symbol Or4k42-ps
Organism Rat
Family 4
Subfamily k
Pseudo Yes
Location chr3:102708766-102709416 (-)
Aliases Olr764-ps

Sequence information


Nucleotide sequence

ATGTACTTCCTATTGGCCAATCTGTCCTTTATTGATATGTGGCTTTCCTCAGTCACCACT
CCTAAGATGATCACAGACTTTCTCAGGGAAAACAAGACCATGTCCTTTGCAGGCTGCATG
TGTCAGGTCTTCTTTGCCCATTGCATCGCTGCAGGAGAGATGGTGCTGTTGGTGGTGATG
GCTTATGATCGCTATGTGGCCATCTGCAAACCCCTCCATTACTTTACCATCATGAACTTG
AAGAGATGCACTGGGTTGGTGTTGACTTCCTGGACAACTGGATTTGTACATGCTATGAGT
CACATGACAGTCATTGTGGAGCTGCCCTTTTGTGGACCTAAGGAAATAGACAGCTTTTTC
TGTGACATGCCATTGGTAATCAAGCTAGCTTGCATGGAATCACGTGACCTCGATATTCTA
ATGAATACTGACTGTGGACTTGTAGCTGTAACCTGCTTTATTCTGTTGCTTATTTCCTAC
ACATATATCCTTATCACTGTATGTCAGAGCTCTAAAGCTAGGGCATCTAAGGCATTGAAC
ACGTGCACTGCCCACATCACTGTGGTGTTGATCTTTTTTGTGCCCTGCATCTTCATTTAT
GTGTGGCCTCTCAATATCACCTGGTTGGACAAATTTCTTGCTGTGTTTTAT


Conceptual translation

MYFLLANLSFIDMWLSSVTTPKMITDFLRENKTMSFAGCMCQVFFAHCIAAGEMVLLVVM
AYDRYVAICKPLHYFTIMNLKRCTGLVLTSWTTGFVHAMSHMTVIVELPFCGPKEIDSFF
CDMPLVIKLACMESRDLDILMNTDCGLVAVTCFILLLISYTYILITVCQSSKARASKALN
TCTAHITVVLIFFVPCIFIYVWPLNITWLDKFLAVFY/VFTPLLNPAIYTLRNNEMKNA
MKRFISNYLG