Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k42 Olfactory Receptor

Gene Symbol Or4k42
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111489221-111490156 (-)
Aliases Olfr1290, GA_x5J8B7W4T2P-84764-83847, MOR248-9

Sequence information


Nucleotide sequence

ATGGATGAAGGCAATCACACTATGGTGTCAGAATTTATACTCTGGGGACTTTCCAGCTCA
CAGAGGATTGAAGTCTTACTCTTCATGGTGTTTTCAATGCTTTATCTTCTCATTGTTTCT
GGAAATATTGTCATTCTGGTTTTAATCACCACTGACCCCCATCTGCATTCTCCCATGTAC
TTCTTGTTGGCCAACCTGTCCTTTATTGATATGTGGCTTTCCTCAGTCACTACTCCTAAG
ATGATTACAGACTTTCTCAGAGAAAACAAGACCATTTCCTTTGCAGGATGCATGTCCCAG
GTCTTCTTTGCCCATTGTATTGCTGCAGGAGAGATGGTGCTGTTGGTGATAATGGCTTAT
GATCGCTATGTGGCCATCTGCAAACCACTCCACTACTTCACCATCATGAATATGAAGAGA
TGCACTGGGTTGGTGTTCACTTCCTGGACAACTGGATTTGTACATGCTCTTAGTCATTTG
GTAGTGATTGTGGAATTGCCTTTTTGTGGACCTAAGGAAATAGATAGCTTTTTCTGTGAC
ATGCCATTGGTAATCAAGCTAGCTTGCATAGATTCCCGTGACTTGGATGTTCTAATGAAT
GCTGATTGTGGACTTGTGGCTGTAACTTGCTTTATTCTGTTGCTTATTTCCTACACATAT
ATTCTTATCACCGTATGTCAGAGCTCTAAAGCTGGTGCATCTAAGGCAATGAACACATGC
ACTGCCCACATTACGGTGGTGCTGATCTTTTTTGTGCCCTGCATCTTCATCTATGTATGG
CCTCTCAATATCACTTGGTTGGATAAATTTCTTGCTGTATTTTACTCTGTTTTTACACCT
CTCCTAAATCCAGCCATTTATACTCTGAGAAATAAAGAGATGAAAAATGCCATGAAAAGA
TTTATAAGTAACTACCTTAGTCACAAAGGAAATTTA


Conceptual translation

MDEGNHTMVSEFILWGLSSSQRIEVLLFMVFSMLYLLIVSGNIVILVLITTDPHLHSPMY
FLLANLSFIDMWLSSVTTPKMITDFLRENKTISFAGCMSQVFFAHCIAAGEMVLLVIMAY
DRYVAICKPLHYFTIMNMKRCTGLVFTSWTTGFVHALSHLVVIVELPFCGPKEIDSFFCD
MPLVIKLACIDSRDLDVLMNADCGLVAVTCFILLLISYTYILITVCQSSKAGASKAMNTC
TAHITVVLIFFVPCIFIYVWPLNITWLDKFLAVFYSVFTPLLNPAIYTLRNKEMKNAMKR
FISNYLSHKGNL