Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k44 Olfactory Receptor

Gene Symbol Or4k44
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111537352-111538287 (-)
Aliases Olfr1294, RP23-336F11.12, MGC157532, MOR248-7

Sequence information


Nucleotide sequence

ATGGATGGAGACAATCAGACTGTTGTGTCAGAATTTATACTCTGGGGACTTGCCCATTCA
AAGAATATTCAGGTCTTGCTATTTGTGATATTTCTGATGCTTTATCTTCTCATCATGTCT
GGAAATATTGTCATCCTGACCTTAATAACCACTGACACCCATCTGCATTCCCCCATGTAC
TTCTTGCTGGCCAACCTGTCTTTTGTTGACATGTGGCTCTCCACAAACACCACTCCTAAG
ATGATCACAGATTTTCTCAGGGAAATCAAGATCATTTCCTTTGCAGGATGTATGTCCCAG
GTCTTCTTTTCCCATTGCATTGCTGCAGGAGAAATGGTGCTGTTGGTGGCAATGGCTTAT
GACCGGTATGTGGCCATCTGCAAGCCACTCCATTACTTCACCATCATGAACCTTAAGAGA
TGCAGCAGTTTGGTGTTGACTTCCTGGACAATTGGCTTTATACATGGTATAATTTACATA
GTAGTGATTGTGCATCTGCCCTTTTGTGGTCCCAATGAAATAGACAGTTTCTTCTGTGAC
ATGCCACTGGTAATAAAACTTGCATGCATGGATTATCATTATTTAAATACCTTAATGAAT
GCTGACTGTGGACTTGTGGCTATAACTTGCTTTATTCTGTTGCTTACTTCCTACACATAT
ATTCTTATGACTGTATGTAAGAGCTCTAAAGCTGGTGCATCTAAGGCAATGAACACTTGC
ACTGCCCACATTACAGTCGTGCTAATCTTTTTTGTGCCCTGCATCTTTATTTATGTGTGG
CCTCTCAATATCACCTGGTTGGACAAATTTTTTGCAGTGTTTTACTCTGTTTTTACACCC
CTCCTAAATCCAGCCATTTATACACTGAGAAATAAAGAGATGAAAAATGCTATGAAAAGG
TTCATAGGCAACTTTCTGGGTCCCAAAGTAAATTTG


Conceptual translation

MDGDNQTVVSEFILWGLAHSKNIQVLLFVIFLMLYLLIMSGNIVILTLITTDTHLHSPMY
FLLANLSFVDMWLSTNTTPKMITDFLREIKIISFAGCMSQVFFSHCIAAGEMVLLVAMAY
DRYVAICKPLHYFTIMNLKRCSSLVLTSWTIGFIHGIIYIVVIVHLPFCGPNEIDSFFCD
MPLVIKLACMDYHYLNTLMNADCGLVAITCFILLLTSYTYILMTVCKSSKAGASKAMNTC
TAHITVVLIFFVPCIFIYVWPLNITWLDKFFAVFYSVFTPLLNPAIYTLRNKEMKNAMKR
FIGNFLGPKVNL