Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k48 Olfactory Receptor

Gene Symbol Or4k48
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111645060-111645995 (-)
Aliases Olfr1298, RP23-336F11.16, MOR248-6

Sequence information


Nucleotide sequence

ATGGATAGAGACAATCAGACTGTTTTGTCAGAATTTGTACTCTTAGGACTTTCCAACTCC
AAGAATCTTCAAGTCTTACTCTTTCTAATCTTCTTATTGCTTTATCTGCTCATCATGTCT
GGAAATATTATCATCCAAATCTTAATCACCACTGACCCCCATCTGCATTCTCCCATGTAC
TTCTTGTTGGCAAACCTATCCTTTGTTGACATGTGGCTCTCCTCAAACACCACTCCTAAG
ATGATCATAGATTTTCTCAGCGAAAACAAGACCATTTCCTTTGCAGGATGCATGTCTCAG
GTCTTTTTATCCCATTGTATTGCTGGAGGAGAGATGGTATTGTTGGTGGTAATGGCTTAT
GACCGCTATGTGGCCATCTGCAAACCACTCCACTACTTCACCATCATGAACTTGAAGAGG
TGCACTGGGTTGGTGTTGACTTCTTGGACAATTGGATTCATACATGGTATAAGCTACTTT
TTAGTGGTTGTGCAGCTTCCTTTCTGTGGTCCCAACAAAATAGATAGTTTCTTTTGTGAC
ATGCCACTGGTAATTAAGCTAGCCTGCATGGATTCCCATGATTTAAATACTTTAATGAAT
GCTGAATGTGGAGTTGTGGCTGTAACCTGCTTTATGCTGTTACTTTTTTCCTACACATAT
ATCCTCATCACTGTTCGCCAGACTTCAAAAAATGGAGCTTCTAAGGCTCTGTCCACATGC
ACTGCACACATCACAGTGGTAATGATCTTCTTTTTGCCCTGCATGTTTATCTATGTGTGG
CCCCTCAGTATCACCTGGTTGGACAAGTTTCTTGCTGTATTTTATTCTGTTTTTACACCT
CTCCTAAACCCAGCCATTTATACACTGAGAAATAAAGAGATGAAAAATGCTATGAAAAGA
TTCATTGGCAAATTTCTGTGTCCCAAAGGAAATTCC


Conceptual translation

MDRDNQTVLSEFVLLGLSNSKNLQVLLFLIFLLLYLLIMSGNIIIQILITTDPHLHSPMY
FLLANLSFVDMWLSSNTTPKMIIDFLSENKTISFAGCMSQVFLSHCIAGGEMVLLVVMAY
DRYVAICKPLHYFTIMNLKRCTGLVLTSWTIGFIHGISYFLVVVQLPFCGPNKIDSFFCD
MPLVIKLACMDSHDLNTLMNAECGVVAVTCFMLLLFSYTYILITVRQTSKNGASKALSTC
TAHITVVMIFFLPCMFIYVWPLSITWLDKFLAVFYSVFTPLLNPAIYTLRNKEMKNAMKR
FIGKFLCPKGNS