Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k49 Olfactory Receptor

Gene Symbol Or4k49
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111664228-111665163 (+)
Aliases Olfr1299, RP23-35G10.1, MOR248-8

Sequence information


Nucleotide sequence

ATGAATGGAGTGAATGAGTCCACGGTGTCAGAATTTGTGCTTTTGGGACTTTCCCGCTCA
CAGAATCTTCAGGTCTTGCTCTTTGTGATATTTTTGATACTTTATCTGCTCATTATTTCA
GGAAACATTGTCATCATGATCTTAATAACCATTGACCGCCATCTCCATTCCCCTATGTAC
TTCTTGTTGGCCAACCTGTCCTTTGTTGATATATGGCTTTCCTCAGTTACCACACCAAAA
ATGGTCATAGACTTTCTCAGGGAACACAAAACCATTTCCTTTGAAGGATGTATGTCCCAG
GTCTTCTTTGCTCATTGCATTGCTGCAGGAGAGATGGTGCTGTTGCTGGTAATGGCATAT
GACCGCTATGTGGCCATCTGTAAACCTCTCCACTATTTCACAATCATGAACCTGAAAAGA
TGCACTGGATTGGTGTTGACTTCCTGGACCGTTGGCTTTGTGCATGCCTTGAGCCAGCTT
GTAGCAGTTCTGCAGCTACCTCTCTGTGGCCCATTGGAAATAGACAGTTTTTTCTGTGAC
ATGCCACTAGTAATCAAACTAGCCTGCACAGATTCCCATGATTTGGACATTTTAATGAAT
GCTGACTGTGGGATTGTAGTTGTATCTTGCTTTATTATGTTGCTCATATCCTACACATAT
ATCCTTATCACTGTTCGCAGGAGCTCTAAGGCTGGGGCATCTAAGGCCCTGTCCACGTGC
ACTGCCCACATCACTGTGGTGATGCTGCTGTTTTTGCCCTGCATCTTCATCTATGTTTGG
CCCCTCAACATCACCTGGTTGGACAAATTTCTTGCTGTGTTTTATTCTGTTGTTACACCT
CTCCTAAATCCAGCCATTTATACACTGAGAAATAAAGAAATAAAAAATGCTCTAAAGAGA
TTTAAAAGCTATGTTATGAATCACAAGGTAAATACT


Conceptual translation

MNGVNESTVSEFVLLGLSRSQNLQVLLFVIFLILYLLIISGNIVIMILITIDRHLHSPMY
FLLANLSFVDIWLSSVTTPKMVIDFLREHKTISFEGCMSQVFFAHCIAAGEMVLLLVMAY
DRYVAICKPLHYFTIMNLKRCTGLVLTSWTVGFVHALSQLVAVLQLPLCGPLEIDSFFCD
MPLVIKLACTDSHDLDILMNADCGIVVVSCFIMLLISYTYILITVRRSSKAGASKALSTC
TAHITVVMLLFLPCIFIYVWPLNITWLDKFLAVFYSVVTPLLNPAIYTLRNKEIKNALKR
FKSYVMNHKVNT