Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4k49 Olfactory Receptor

Gene Symbol Or4k49
Organism Rat
Family 4
Subfamily k
Pseudo No
Location chr3:102841615-102842550 (+)
Aliases Olr770

Sequence information


Nucleotide sequence

ATGAATGGAGGAAATCAGTCTGAGCTGTCAGAATTTGTGCTTTTGGGACTTTTTCGCTCA
CAGAATCTTCAGGTTGTGCTCTTTGTGATATTTTTGATATTTTACCTGCTCATTGTTTCA
GGAAACATTGTCATCATGTTCTTAATAACCATTGACCGTCATCTCCATTCCCCTATGTAC
TTCTTGTTGGCCAATCTGTCCTTTGTTGATATATGGCTTTCCTCAGTTACCACTCCAAAA
ATGATCACAGACTTTCTCAGGGAACACAAGACCATTTCCTTTGCAGGATGCATGTCCCAG
GTCTTCTTTGCCCATTGCATTGCTGCAGGAGAGATGGTGCTCTTGCTGGTGATGGCTTAT
GACCGCTATGTGGCCATCTGCAAACCACTCCACTATTTCACCATCATGAACTTGAGAAGA
TGCACTGGATTGGTGTTGACATCCTGGACTGTTGGCTTTGTGCATGCCTTGAGTCAGCTT
GTAGCAGTTCTGCAGCTACCTCTCTGTGGCCCATTGGAAATAGACAGTTTTTTCTGTGAC
ATGCCACTGGTAATCAAGCTCGCCTGCATAGATTCCCATGATTTGGACATGTTAATGAAT
GCTGACTGTGGGATAGTGGTTGTATCCTGCTTTATTCTGTTACTCATATCCTACACATAT
ATCCTTGTCACTGTTCACAGGAGCGCTAAAGCTGGAGCATCTAAGGCCCTGTCCACATGC
ACTGCCCACATCACCGTGGTGATGCTCCTTTTTCTGCCCTGCATCTTCATCTATGTGTGG
CCCCTCAATATCACCTGGTTGGACAAATTTCTTGCTGTGTTTTATTCTGTTGTTACACCT
CTCCTAAATCCAGCCATTTATACACTGAGAAACAAAGAAATAAAAAATGCTCTAAAGAGA
TTTAAAAGCTATGTTATTAATCACAAGGTAAATACT


Conceptual translation

MNGGNQSELSEFVLLGLFRSQNLQVVLFVIFLIFYLLIVSGNIVIMFLITIDRHLHSPMY
FLLANLSFVDIWLSSVTTPKMITDFLREHKTISFAGCMSQVFFAHCIAAGEMVLLLVMAY
DRYVAICKPLHYFTIMNLRRCTGLVLTSWTVGFVHALSQLVAVLQLPLCGPLEIDSFFCD
MPLVIKLACIDSHDLDMLMNADCGIVVVSCFILLLISYTYILVTVHRSAKAGASKALSTC
TAHITVVMLLFLPCIFIYVWPLNITWLDKFLAVFYSVVTPLLNPAIYTLRNKEIKNALKR
FKSYVINHKVNT