Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4k50 Olfactory Receptor

Gene Symbol Or4k50
Organism Rat
Family 4
Subfamily k
Pseudo No
Location chr3:102859815-102860756 (+)
Aliases Olr771

Sequence information


Nucleotide sequence

ATGAATGAAGTAAATCAATCCGTGGTATCAGAATTTGTGCTTTTGGGACTTTCCCACTCA
CAGAATCTTCAGGTTTTGCTCTTTGTGATATTTTTGATAGTTTATCTGCTCATTCTGTCA
GGAAATATTGTCATTGTGATCTTAATAACCATTGACCGTCATCTCCATTCCCCTATGTAT
TTCTTGCTAGCCAACCTGTCCTTTGTTGATATATGGCTTTCCTCAGTTACCACTCCAAAA
ATGGTCACAGACTTTCTCAGGGAAAACAAGACCATTTCCTTTGCAGGCTGCATGTCCCAG
GTCTTCTTTGACCATTGCATCGGTGCAGCAGAGATGGTGTTGTTACTGGTGATGGCTTAT
GACCGCTATGTGGCCATCTGCAAACCACTCCACTATTTCACCATTATGAACCTGAAAAGA
TGTGCTGCACTGGTGTTAATTTCCTGGACAATTGGCTTTGTACATGCCTTGAGTCAACTT
GTACCAGTTCTGCAACTACCTCTCTGTGGCCCATTGGAAATAGACAGTTTTTTCTGTGAC
ATACCACTGGTAATCAACCTAGCCTGCATGGATTCCCATGACTTGGATACTTTAGTAAAT
GCTGACTGTGGGGTTGTGGTTGTAACTTGCTTTATTCTGTTGCTTATATCCTATACATAT
ATTCTTATCACTGTTCATCAGAGTTCTAAGACTGGGGCATCTAAAGCCCTGTCCACATGC
ACTGCCCACATCACTGTGGTGTTGCTTCTTTTTGTGCCCTGTATCTTCATCTATGTGTGG
CCCCTCAATATCACCTGGTTTGACAAATTTCTTGCTGTGTTTTATTCTGTTGTTACACCT
CTCCTAAATCCAGCCATTTATACACTGAGAAATAAAGATATAAAACATTCTCTAAAGAGA
TTAAAAGGATATTTTATGAATCACAGGGTAAGGGTAAATACT


Conceptual translation

MNEVNQSVVSEFVLLGLSHSQNLQVLLFVIFLIVYLLILSGNIVIVILITIDRHLHSPMY
FLLANLSFVDIWLSSVTTPKMVTDFLRENKTISFAGCMSQVFFDHCIGAAEMVLLLVMAY
DRYVAICKPLHYFTIMNLKRCAALVLISWTIGFVHALSQLVPVLQLPLCGPLEIDSFFCD
IPLVINLACMDSHDLDTLVNADCGVVVVTCFILLLISYTYILITVHQSSKTGASKALSTC
TAHITVVLLLFVPCIFIYVWPLNITWFDKFLAVFYSVVTPLLNPAIYTLRNKDIKHSLKR
LKGYFMNHRVRVNT