Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k51 Olfactory Receptor

Gene Symbol Or4k51
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111754251-111755186 (+)
Aliases Olfr1301, RP23-88C15.1, MOR248-5

Sequence information


Nucleotide sequence

ATGGATGGAAGTAATCGCTCCCTGGTATCAGAATTTGTGCTTTTGGGACTTGCCCGCTCA
CAGAATCTTCAGGTCTTACTCTTCATAATATTTTTGGTGGTTTATCTGCTCATTCTATCT
GGAAATACTATTGTCATGTTCTTAATCATCACTGACAAGAATCTCCATTCTCCCATGTAC
TTCTTTTTGGCCAACCTGTCCTTTGTTGATATGTGGCTTTCCTCAGCCACCACTCCTAAG
ATGATCACAGATTTTCTCAAAGAACCAAAGATCATTTCCTTTGCAGGCTGCATGTCCCAG
GTCTTCTTTGACCATTGTGTTGGTGCAGTAGAGATGTTGCTGTTGGTGGTAATGGCTTAT
GACCGCTATGTGGCCATCTGCAAACCACTTCACTATTTCACTATTATGAGCCTGAAAAGA
TGTGCTGGGTTGGTGTTAACTTCCTGGGCAATTGCCTTTGTGCATGCCATGAGTCAGCTT
TTGGCAGTTGTGCAACTGCCTCTCTGTGGTCATATGGAAATTGACAGTTTCTTCTGTGAC
ATACCACTTATAATCAAGCTAGCTTGCATGGATTCCCATATTTTGGATATTTATATGAAT
GTCGACTGTGGGTTTGTGGTTGTAACCTGCTTTATTCTGTTGCTCATATCTTACACATAT
ATCCTTCTCACTGTTCGCCAGAGCTCTAAAGCTGGGGCATCTAAGGCTCTGTCAACATGC
ACTGCTCACATCACAGTAGTGATGATCTTTTTTGTGCCCTGCATCTTCATCTATGTGTGG
CCCCTCAGTATCACCTGGTTAGACAAATTTCTTGCTGTGTTTTATACTGTTTTTGCACCT
CTCCTAAATCCAGCCATTTATACACTAAGAAATAAAGAGATGAGAAATGCTGTAAAGAAG
TTAAAAAACCATTTTATGGATTATAAGGGAAATACT


Conceptual translation

MDGSNRSLVSEFVLLGLARSQNLQVLLFIIFLVVYLLILSGNTIVMFLIITDKNLHSPMY
FFLANLSFVDMWLSSATTPKMITDFLKEPKIISFAGCMSQVFFDHCVGAVEMLLLVVMAY
DRYVAICKPLHYFTIMSLKRCAGLVLTSWAIAFVHAMSQLLAVVQLPLCGHMEIDSFFCD
IPLIIKLACMDSHILDIYMNVDCGFVVVTCFILLLISYTYILLTVRQSSKAGASKALSTC
TAHITVVMIFFVPCIFIYVWPLSITWLDKFLAVFYTVFAPLLNPAIYTLRNKEMRNAVKK
LKNHFMDYKGNT