Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k52 Olfactory Receptor

Gene Symbol Or4k52
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr2:111780313-111781257 (+)
Aliases Olfr1302, RP23-88C15.2, MOR248-3

Sequence information


Nucleotide sequence

ATGAGTAAAATGGATGGAGGTAATCACTCCCTGGTATCAGAATTTGTGCTTTTGGGACTT
GCCCACTCACAGAATATTCAAGCACTACTCTTCATGATATTTTTGATGCTTTATCTGCTC
ATTGTATCAGGAAATATTGTCATCATGGTCTTAATAACCACTGACCCCCATCTTCATTCC
CCTATGTACTTTCTGTTGGCCAACCTATCCTTTGTTGATATGTGGCTTTCCTCAGTAACT
ACTCCTAAGATGATCACAGACTTTTTCAGGGAAAACAAGACCATTTCCTTTTCAGGCTGC
ATGTCCCAGGTCTTCTTTGCTCATTGCATTGCTGCAGGAGAGATGGTGCTGTTGGTAGTA
ATGGCATATGACCGTTATGTGGCCATCTGCAAGCCACTCCACTACTTCACCATCATGAAC
CTGAAAAGATGCACTGGGTTGGTGTTGACTTCCTGGACCATTGGCTTTGTGCATGCCTTG
AGTCACCTGGTAGTGATTGTGGAACTGCCTTTTTGTAGCGCCAAGGAAATCGATAGTTTC
TTCTGTGACATGCCTCTGGTAATCAAGCTAGCCTGTATGGATTCTCATAATTTGGATATT
TTAATGTATGCTGACTGTGGAGTTGTAGGAGTAACCTGCTTTATTCTGCTGCTCATATCC
TACACATATATCCTTATCACTGTTCGAAGGAGCTCTAAGGCTGGGGCATCTAAGGCCCTG
TCCACGTGCACTGCCCACATCACCGTGGTGATGATCTTTTTTGTGCCCTGCATCTTCATC
TATGTTTGGCCCCTCAACATCACCTGGCTGGACAAATTTCTTGCTGTATTTTACTCTGTT
TTTACACCTCTCTTAAATCCAGCCATTTATACACTGAGAAATAAAGAGATGAAAAATGCT
ATGAGACGGTTCATAAACAACTACATGGATTCCCAAGGGAAGTCC


Conceptual translation

MSKMDGGNHSLVSEFVLLGLAHSQNIQALLFMIFLMLYLLIVSGNIVIMVLITTDPHLHS
PMYFLLANLSFVDMWLSSVTTPKMITDFFRENKTISFSGCMSQVFFAHCIAAGEMVLLVV
MAYDRYVAICKPLHYFTIMNLKRCTGLVLTSWTIGFVHALSHLVVIVELPFCSAKEIDSF
FCDMPLVIKLACMDSHNLDILMYADCGVVGVTCFILLLISYTYILITVRRSSKAGASKAL
STCTAHITVVMIFFVPCIFIYVWPLNITWLDKFLAVFYSVFTPLLNPAIYTLRNKEMKNA
MRRFINNYMDSQGKS