Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4o1-ps Olfactory Receptor

Gene Symbol Or4o1-ps
Organism Rat
Family 4
Subfamily o
Pseudo Yes
Location chr3:78242957-78243593 (-)
Aliases Olr699-ps, Olr699-ps

Sequence information


Nucleotide sequence

TTTGTCAGCTTGATTCCCTCACTACAGAGTTTCTCCTCACAATTTCATAGAGAGCCCTGT
TTCTCTGACCTTCCTTCTGAAAAAATAAGCCAAATAGAAAAGTAAATGGAATAAGAAAAA
AACAGAATTTGTTTTCTTGGGTAACAATCAGGATTCTGCTGGACAACAAATATTGTCATG
CTTTTGTTCATCTATACTGTGACAATAATGGACAGCTTACTTATTCTGGGGGCAATGGTT
GCCAGTCCCTCCTTGGGCATTTCATTGTACTTCTTTCTATGTTGTTTATTCCACTGCCTT
CTCATCCTAATTAATTTTATAGTTACTATGTGATGAAAAAATTATTTCATTTCCAGTTTG
CATGGGGCAGAACCTAATAGCACAATTCTCTGGTGGGGCCGAAGCCTTCCTTTTGATGGT
GATTGCCACCTGCAAGCTGCTGCACTATTTGTCATAAATCAGGCTTATATTTGCCCATTC
GTAGTACAGTCTGAAAGAGGATTTTCATCTTCTCTGGTTTAATTTCTTCTTGTATTTGTC
TTTATTTTTTAAAAGGGGAATAACTTCATGCAATATATTTTGATCATGTTTTACCTTCCA
CCAATTCCTCCCACATCCTCCCCATCTTTCAACTCAC


Conceptual translation

TEFVFLGNNQDSAGQQIL/MLLFIYTVTIMDSLLILGAMVASPSLGISLYFFLCC\ST
AFSS*LIL*LLCDEKIISFPVCMGQNLIAQFSGGAEAFLLMVIATCKLLHYLS*IR/YI
CPFVVQSERGFSSSLV*FLLVFVFIF