Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4p18 Olfactory Receptor

Gene Symbol Or4p18
Organism Mouse
Family 4
Subfamily p
Pseudo No
Location chr2:88402012-88402932 (-)
Aliases Olfr1179, RP23-195I21.2, MOR225-2, RP23-195I21.2, MOR225-2

Sequence information


Nucleotide sequence

ATGGAAAGTACCAATAATATCACTGAATTTATACTGTTAGGACTTTCCCAGAACAAGAAA
ATTAAAGCTCTATGTTTTCTGATGTTCTTGTTTTGTTACATAGCTATTTTGGGAGGAAAC
ATGATCATTTTGATTTCTATCACATGTAGCCAGCTAATTGAGCAACCAATGTATTTCTTT
CTTAATTACCTTGCTTTGTCAGACCTGTGCTATACCTCCACAGTGACACCCAAGTTTCTC
ACTGACCTTCTCGTAGAAAGGAACAAAATTTCTTATACAAGCTGCATGGCTCAGCTTTTT
ACCATGCATTTCTTTGGAGGGATTGAGATCCTCATACTCACAGTGATGGCCTATGACCGC
TACGTGGCCATCTGCAAGCCCCTGCACTATTCCATCATCATGAGCAGAGGGAGGTGCCAT
GCCATGGTCACTGCTTGCTGTGCTGGTGCTTTTATACATTCCTTCCTCCAGAGCCTCCTT
GCTATCAGCCTCCCCTTCTGTGGCCACAATGAGATGGATCACTATTTCTGTGATATTTAT
CCTTTGCTAACTCTTTCCTGCACCAATACGCACAGAGTCGGACTTCTGGTGGTTGCCAAT
TCAGGCATGATGGGACTGGTCACCTTCGTAGTCTTGATGTGGTCTTACTATTTCATTTTA
TACACCATCAGGGCTTATCCTGCAGAGAGCCGCAGCAAAGCTCTTTCCACATGCAGTTCT
CATGTCACTGTTGTCATTTTCTTCTTTGTGCCTGTACTTTTTATTTATATCAGACCAGCC
ACCACTTACCCAGAAGATAAAGTGTTTGCTCTTTTCTACACCATCTTAGCTCCCATGTTC
AACCCTCTGATCTACACTCTGAGAAACACAGAGATGAAGAATGCCTTGAGAAAAGTTTGG
TGCCACAAACTATTTTTTATT


Conceptual translation

MESTNNITEFILLGLSQNKKIKALCFLMFLFCYIAILGGNMIILISITCSQLIEQPMYFF
LNYLALSDLCYTSTVTPKFLTDLLVERNKISYTSCMAQLFTMHFFGGIEILILTVMAYDR
YVAICKPLHYSIIMSRGRCHAMVTACCAGAFIHSFLQSLLAISLPFCGHNEMDHYFCDIY
PLLTLSCTNTHRVGLLVVANSGMMGLVTFVVLMWSYYFILYTIRAYPAESRSKALSTCSS
HVTVVIFFFVPVLFIYIRPATTYPEDKVFALFYTILAPMFNPLIYTLRNTEMKNALRKVW
CHKLFFI