Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p18b Olfactory Receptor

Gene Symbol Or4p18b
Organism Rat
Family 4
Subfamily p
Pseudo No
Location chr3:78086943-78087890 (+)
Aliases Olr691, Olr691

Sequence information


Nucleotide sequence

ATGGAAAGTACCAATAACATCACTGAATTTATACTGTTAGGACTTTCCCAGAACAAGAAA
ATTAAAACTCTATGTTTTCCGTTGTTCTTGTTTTGTTACATAAGTATTTTGGGAGGAAAC
ATGTTCATTTTGATTTCTATCACATATAGCCAGCTAGTTCAGCAACCAATGTATTTTTTT
CTTAATTACCTTGCTTTGTCAGACCTCTGCTATACCTCCACAGTGACACCCAAGTTTCTC
AGTGATCTCATCATAGAAAGGAACATAATTTCTTATACCAGTTGCATGCTTCAGCTTTTT
ACCATGCACTTTTTTGGAGGGATTGAGATCCTCATACTCACAGCGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCACTGCACTACACCATCATCATGAGTAGAGGGAGGTGTCAA
GCCATGGTCACTGCTTGCTGTGCTGGCGCTTTTATACATTCTTTCTTCCAGAACCTCCTT
GCTATCAGCCTCCCCTTTTGTGGCCACAATGAGATGGATCACTATTTCTGTGATATTTAC
CCTTTGCTGACTCTTGCTTGCACCAATACAAGCAGAGTTGGACTTCTGGTAGTTGCCAAT
ACAGGCATGATGGGACTGGTCACATTTTTAGTCTTGATGTGGTCTTACTCTTTCATATTA
TACACTATTAGGGCGTACCCTGCAGAGAGCCGCAGAAAAGCTCTTTCCACATGCAGTTCT
CATGTCACTGTTGTAATCTTATTCTTTGTGCCTGTACTATTTATTTACATCCGACCAGCA
ACCACTTATCCAGAAGATAAAGTGTTTGCTCTTTTCTACACCATCTTAGCTCCCATGTTC
AATCCTTTGATCTACACACTGAGAAACACAGAGATGAAGAATGCCTTGAGAAAAGTTTGG
TGCCACAAGCTATTTTTATTTAAAAGAGAATCTTATGATATCTACTGT


Conceptual translation

MESTNNITEFILLGLSQNKKIKTLCFPLFLFCYISILGGNMFILISITYSQLVQQPMYFF
LNYLALSDLCYTSTVTPKFLSDLIIERNIISYTSCMLQLFTMHFFGGIEILILTAMAYDR
YVAICKPLHYTIIMSRGRCQAMVTACCAGAFIHSFFQNLLAISLPFCGHNEMDHYFCDIY
PLLTLACTNTSRVGLLVVANTGMMGLVTFLVLMWSYSFILYTIRAYPAESRRKALSTCSS
HVTVVILFFVPVLFIYIRPATTYPEDKVFALFYTILAPMFNPLIYTLRNTEMKNALRKVW
CHKLFLFKRESYDIYC