Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p19b-ps Olfactory Receptor

Gene Symbol Or4p19b-ps
Organism Rat
Family 4
Subfamily p
Pseudo Yes
Location chr3:76484282-76485408 (-)
Aliases Olr620-ps, Olr620-ps

Sequence information


Nucleotide sequence

ACAGGCTGATATTAGTGTTAATTGTAAAAATCTCCATATTGATGTCTTTCATTAATCTGT
CTTTTCAGGGACCTGTCATGTTTTTCTAATTCACTGAACTATGGGGAATGTTACTGTGTT
TATTGTCTTGGGACTTTCTGACAATGAAAATATTGAAGTCCTCTGTTTTGTATTATTTCT
ATTTTTGCTACATTGCTATTTGGATGGGCAATGTTCTCATAATGGTTTCTATCACATGCA
CTAAGCTCATGAACCAACCCATGTATTTCTTTCTTCATTACCTATCACTTTGTGATCTTT
GTTACACATCCACAGTGACACCAAACTCCTGATTGATTTACTGGCAGAAAGGAAGATTAT
TTCCTATAATAACTGCATGGCACAGCTCTTTCTTCTTCATTTGCTTGGTGCCATTGAGGT
CTTTATTCTCACAGCAATGGCCTATGACCATTATGTGGCGATCTGCAGGCCCCTGCACTA
CACCATCATTATGAGCAGACAGAGATGCAATGAACTCCTTGCAGTTTGTTGCACTGGAGG
ATTTGTGCACTCAGCCAGTCAGTCCCTTCTCATTGCCTTTGTGTCCTTTTGTCATCACAA
TGAGATAGACCACTACTTCTGTGATGTATATCCTTTACTGAAATTGGCTTGCACTGATAC
ACATAGAATTGGCCTGTTTGTTATTGTTGATTCTGGACTACTTGCTTTGGTGACATTTGT
AGTTTTAATGGTATCTTATTTTCTAATACTACATACCATAAGTGTTTACCCAGCAGAGAG
CCGTTCCAAAGCTCTTTCCACATGCGGTTCACATATAACCATTGTGGTCCTGTTTTTTGT
GCCTGTTGTCTTCATTTACATCAGACCAAATACAACATTCCCAGAAGACAAAGTGTTTGC
TCTTTTCTATACCATCATAGCTCCCATGTTCAATCTGATCTACACATTGAGAAACCTGGA
GATGAAGTGTGCAATTAAAAAAATGTGGTATCATCAAATACCTTCATACAAGAAACAAAT
TCCATAAAGACATAAAAAAAGTGTATAACTGTCTTCTTCTTTTCTCTAATTATTAGATTT
TAAAAACAGTTCACAGGATTTTTTGTGTGTCCTTCCCCCCACTCCTT


Conceptual translation

MGNVTVFIVLGLSDNENIEVLCFVLFLFL\IAIWMGNVLIMVSITCTKLMNQPMYFFLH
YLSLCDLCYTSTVT/KLLIDLLAERKIISYNNCMAQLFLLHLLGAIEVFILTAMAYDHY
VAICRPLHYTIIMSRQRCNELLAVCCTGGFVHSASQSLLIAFVSFCHHNEIDHYFCDVYP
LLKLACTDTHRIGLFVIVDSGLLALVTFVVLMVSYFLILHTISVYPAESRSKALSTCGSH
ITIVVLFFVPVVFIYIRPNTTFPEDKVFALFYTIIAPMFNLIYTLRNLEMKCAIKKMWYH
QIPSY