Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p20 Olfactory Receptor

Gene Symbol Or4p20
Organism Rat
Family 4
Subfamily p
Pseudo No
Location chr3:76625673-76626605 (-)
Aliases Olr625, Olr625

Sequence information


Nucleotide sequence

ATGGAATGCCAGAGGAACATTTCAGAATTTCTCCTCATGGGGCTATCTTCCAAGCACAAT
ATTGAAGTGCTTTGCTTCATTTTCTTCTTATTCTGCTACTTTGCCATCTTGTGTTGGAAT
CTTCTCATCTTTTTCTCAATTAGATACAGTTCTCTCTTCAATCAACCCATGTACTATTTC
CTCAGTCATTTATCTTCTATGGACATTTGCTATACCTCCTGTGTGACACCCAAACTGATT
GGGGATCTGCTTGTAAGGAGAAAAACCATCTCTTATACCAACTGCATACTGCAGGTATTT
GTCATGCACTTTTTTGGAATGATTGAAATCTTATTTCTGACAGCCATGGCCTTTGACCGC
TGTGTGGCCATCTGTAGGCCTCTTCACTACATGGTCATCATGAGCAGTCCCAGGTGCCAT
GTTCTTATCTGGACTTCCTGGATTGGTGGTGTTGCCCATTCCCTTCCCCAGGTTATGATG
CTAATCTGTTTGCCCTTCTGTGGCCCCAATGAAATTGACAACTACTACTGTGACGTTTTC
TCTTTGCTGAAAGTTGCTTGCACTGACACCTACATCACTGGTATCCTCATGGTTGCCAAT
TCAGGAGTTGTTGCCTTTGTAATCTTTGTTCTCTTGTTTGGCTCATATGTAGTTATACTG
TTCACATTAAGGAATTACTCAGCAGAAGGGAGACGCAAAGCTCTTTCTACCTGTGGGTCC
CATATCTCTGTGGTTATTTTATTTTTTGGACCTTCCATCTATTCCTACCTTAGACCACCT
ACCACTTACCCTGAGGACAAAATCTTTGCCCTGTTTTATACTATTATTGCTCCTATGTTC
AACCCCCTGATATATACTCTAAGAAATACAGAGATGAAGACTGCCATAAAAAAGGTATGG
TGTCAGAGAATATTTTTAGGAGAAAACCATAAT


Conceptual translation

MECQRNISEFLLMGLSSKHNIEVLCFIFFLFCYFAILCWNLLIFFSIRYSSLFNQPMYYF
LSHLSSMDICYTSCVTPKLIGDLLVRRKTISYTNCILQVFVMHFFGMIEILFLTAMAFDR
CVAICRPLHYMVIMSSPRCHVLIWTSWIGGVAHSLPQVMMLICLPFCGPNEIDNYYCDVF
SLLKVACTDTYITGILMVANSGVVAFVIFVLLFGSYVVILFTLRNYSAEGRRKALSTCGS
HISVVILFFGPSIYSYLRPPTTYPEDKIFALFYTIIAPMFNPLIYTLRNTEMKTAIKKVW
CQRIFLGENHN