Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4p22 Olfactory Receptor

Gene Symbol Or4p22
Organism Mouse
Family 4
Subfamily p
Pseudo No
Location chr2:88486734-88487666 (+)
Aliases Olfr1184, RP23-209L8.6, MOR225-3, RP23-209L8.6, MOR225-3

Sequence information


Nucleotide sequence

ATGGAATGTAAGAGGAACATATCAGAATTTCTTCTTATGGGGCTGTCTTCTAAGCGGAAC
ATTGAGGTGTTTTGCTTCCTTTTCTTCTCATTCTGTTACCTTGCCATCTTGTGTGGGAAT
CTGCTGATCCTTATCTCCATTAGATGTAGTTCTCTGTTTAACCAACCCATGTACTATTTC
CTCAGTCATTTATCTTCTATGGACATTTTCTATACCTCCTGTGTGACACCCAAACTGATT
GGAGATCTTCTAGTGAGAAGAAAAACTATCTCTTATACAAACTGCATGCTACAGGTCTTT
GCCATGCACTTCTTTGGAATGATTGAAATCTTAATCCTAACAGCCATGGCCTTTGACCGC
TGCGTGGCCATCTGCAAGCCTCTCCACTACATGGTCATCATGAGCAGAAGCAGGTGCCAT
ATCCTGATCTGGGCTTCTTGGGTTGGTGGTGCTGCACACTCCTTGTCTCAGTTTTGTTTG
CTAATCTGCTTGCCTTTCTGTGGCCCCAATGAAATAGACCACTACTACTGTGACATTTTC
CCTTTGCTGAAAGTTGCCTGTACCGACACCACCATCACTGGTGTCCTGGTGGTTGCCAAT
TCAGGACTGATTGCTTTAGTAACCTTTGTTGTCTTGTTCGGGTCATATGTGGTTATACTG
TTCACATTAAGGAATTACTCTGCAGAAGGAAGACACAAAGCCCTTTCTACCTGTGCATCT
CATATCACTGTGGTTATTTTATTCTTTGGACCTTCCATCTTTGCTTACCTTAGACCTCCT
ACCACTTTCCCTGAGGACAAAATCTTTGCTCTATTTTACACCATCATTGCTCCTATGTTC
AATCCCCTCATATATACTTTAAGAAATACAGAGATGAAAAAGGCAATGAAAAAGGTTTGG
TGTCAAAACATGTTTTCAGAAGAGAAACATAGT


Conceptual translation

MECKRNISEFLLMGLSSKRNIEVFCFLFFSFCYLAILCGNLLILISIRCSSLFNQPMYYF
LSHLSSMDIFYTSCVTPKLIGDLLVRRKTISYTNCMLQVFAMHFFGMIEILILTAMAFDR
CVAICKPLHYMVIMSRSRCHILIWASWVGGAAHSLSQFCLLICLPFCGPNEIDHYYCDIF
PLLKVACTDTTITGVLVVANSGLIALVTFVVLFGSYVVILFTLRNYSAEGRHKALSTCAS
HITVVILFFGPSIFAYLRPPTTFPEDKIFALFYTIIAPMFNPLIYTLRNTEMKKAMKKVW
CQNMFSEEKHS