Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p22 Olfactory Receptor

Gene Symbol Or4p22
Organism Rat
Family 4
Subfamily p
Pseudo No
Location chr3:76890792-76891730 (+)
Aliases Olr639, Olr639

Sequence information


Nucleotide sequence

ATGGAATGCAAGAGGAACATATCAGAATTTCTTCTCATTGGACTGTCTTCTAAGCAGAAC
ATTGAAGTGTTTTGCTTCCTGTTCTTCTCCTTCTGTTACCTTGCCATCTTGTCTGGGAAT
CTGGTGATCCTTATCTCTGTCAGATGCAGTTCTCTTTTTAACCAACCCATGTACTATTTT
CTCAGTCATTTATCTTCTATGGACATTTGCTATACCTCCTGTGTGACACCCAAACTGATT
GGAGATCTGCTTGTGAGAAGAAAATATATCTCTTATACAAACTGTATGCTACAGGTCTTT
GCCATGCACTTTTTTGGCATTATTGAAGTCTTAATCCTAGCAGCCATGGCCTTTGACCGT
TGTGTGGCCATCTGCAAGCCTCTCCACTACATGCTCATCATGAGCAGAAGCAAATGCCAT
GTCTTGATCTTGGTCTCTTGGGTTGGTGGGGCTGCACACTCCTTTTCTCAGTTTTGTTTG
CTAATCTGCTTGCCCTTCTGTGGCCCCAATGAAATAGACCACTACTACTGTGACATTTTC
CCTTTGCTGAAAGTTGCCTGTACTGACACCACCATTGCTGGTATGCTCGTTGTTGCCAAT
TCAGGACTGATAGCTTTGGTAACCTTTGTTCTCTTATTTGGTTCATATGTGGTTATACTG
TTCACATTAAGGAATTACTCTGCGGAACAAAGACACAAAGCTCTTTCTACATGTGGATCC
CATATCACTGTGGTCATTTTATTCTTTGGACCTTCCATCTTTGCTTACCTTAGACCTCCT
ACTACTTTCCCTGAGGACAAAATCTTCGCTCTATTTTATACAATCATTGCTCCTATGTTC
AATCCCCTTATATATACTTTAAGAAATACAGAGATGAAAAAGGCTATAAAAAAGGTTTGG
TGTCAAAAGAGATTTTTCAGAAGAGAAACAGTTAACTTT


Conceptual translation

MECKRNISEFLLIGLSSKQNIEVFCFLFFSFCYLAILSGNLVILISVRCSSLFNQPMYYF
LSHLSSMDICYTSCVTPKLIGDLLVRRKYISYTNCMLQVFAMHFFGIIEVLILAAMAFDR
CVAICKPLHYMLIMSRSKCHVLILVSWVGGAAHSFSQFCLLICLPFCGPNEIDHYYCDIF
PLLKVACTDTTIAGMLVVANSGLIALVTFVLLFGSYVVILFTLRNYSAEQRHKALSTCGS
HITVVILFFGPSIFAYLRPPTTFPEDKIFALFYTIIAPMFNPLIYTLRNTEMKKAIKKVW
CQKRFFRRETVNF