Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p22d Olfactory Receptor

Gene Symbol Or4p22d
Organism Rat
Family 4
Subfamily p
Pseudo No
Location chr3:76,768,000-76,769,000 (+)
Aliases Olr634

Sequence information


Nucleotide sequence

ATGGAATGCAAGAGGAACATATCAGAATTTCTTCTCATTGGACTGTCTTCTAAGCAGAAC
ATTGAAGTGTTTTGCTTCCTGTTCTTCTCCTTCTGTTACCTTGCCATTTTGTCTGGGAAT
CTGATGATCCTTATCTCTGTCAGATGCAGTTCTCTTTTTAACCAACCCATGTACTATTTT
CTCAGTCATTTATCTTCTATGGACATTTGCTATACCTCCTGTGTGACACCCAAACTGATT
GGAGATCTGCTTGTGAGAAGAAAATATATCTCTTTTACAAACTGTATGCTGCAGGTCATT
GCCATGCACTTTTTTGGCCTTATTGAAGTCCTGATTCTAGCAGCCATGGCCTTTGACCGT
TGTGTGGCCATCTGCAAGCCTCTCCACTACATGCTCATCATGAGCAGAAGCAAGTGCCAT
GTCTTGATATTGGTCTCTTGGGTTGGTGGAGCTGCGCACTCCTTTTCTCAGTTTTGTTTG
CTAATCTGCTTGCCCTTCTGTGGCACCAATGAAATAGACCACTACTACTGTGACATTTTC
CCTTTGCTGAAAGTTGCCTGTACTGACACCACCATTGCTGGTATCCTCGTTGTTGCCAAT
TCAGGACTGATAGCTTTGGTAACCTTTGTTCTCTTATTTGGTTCATATGTGGTTATACTG
TTCACATTAAGGAATTACTCTGCAGAAGGAAGACACAAAGCTCTTTCTACATGTGGATCC
CATATCACTGTGGTCATTTTATTCTTTGGACCTTGCATCTTTGCTTACCTTAGACCTCCT
ACTACTTTCCCTGAGGACAAAATCTTCGCTCTATTTTATACAATCATTGCTCCTATGTTC
AATCCCCTTATATATACTTTAAGAAATACAGAGATGAAAAAGGCTATAAAAAAGGTTTGG
ATTCAAAAGAGATTTTTCAGAAGAGAAACAGTTAATCTT


Conceptual translation

MECKRNISEFLLIGLSSKQNIEVFCFLFFSFCYLAILSGNLMILISVRCSSLFNQPMYYF
LSHLSSMDICYTSCVTPKLIGDLLVRRKYISFTNCMLQVIAMHFFGLIEVLILAAMAFDR
CVAICKPLHYMLIMSRSKCHVLILVSWVGGAAHSFSQFCLLICLPFCGTNEIDHYYCDIF
PLLKVACTDTTIAGILVVANSGLIALVTFVLLFGSYVVILFTLRNYSAEGRHKALSTCGS
HITVVILFFGPCIFAYLRPPTTFPEDKIFALFYTIIAPMFNPLIYTLRNTEMKKAIKKVW
IQKRFFRRETVNL