Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p24-ps Olfactory Receptor

Gene Symbol Or4p24-ps
Organism Rat
Family 4
Subfamily p
Pseudo Yes
Location chr3:76531874-76532950 (+)
Aliases Olr622-ps, Olr622-ps

Sequence information


Nucleotide sequence

AGAAATATCTATAATTTTTCAGTCATGTTTATATAGTTGTGATTAAGTTTCAATTGTTGC
TTCTGAAATTCTCTTTTTCATACATCAGTGTTTTTGCACAGAGAATAATAAAGGGAATGC
CAGAGGACTCTTTATCAGGGTACTGTCTTCTAAGTAGATCATTCAAGTGTGTTGGTTCAT
GTTCTGCTAATTCTGTTACTTTGCCATCATGTCAGGGAATTTGCTGATCTTTTACTTAGA
TACAGTTTTCTATTTAACCAGCCAACATACCATTTCCTCAGTCATTTCATCTTCTATGGA
TATTTTCTAAGCCTCTAGTGTGACATCCAAACTGATTTGAAATCTGCTAGTGAGAAAAAA
CAAACCTCACTTTCACAAACTGCATATAGCATGTGTTTCCCATCACTTCTGTAGGATTAT
TGAGGACTTAATCCTAGGAGTCATGACTTTTGATCATTGTATGACCATCTGTAGGCTTCT
TCATGATATGGTCATCATAAGTAGAACACAGGTGCCATGTCCTGACTTAGTTTTACTGGG
TTGGTGTGGCTGAGCACTCCTTTTCTCAATGCTGTTTGATAGTCTGTTTATTGTTCTGTG
GCCCTATTGAAATAGATAACTATTACTGTGACACTTGCCCTTTGCTGAACATTGCCAGTA
CTGGCACTTACTTTAATAGAGTTCTCATTGTTGCCAATTCAGAAATGGTTGTCTTTGTAA
TCTTGGCTCTTTGTTTTGTTTCATATGTAGTTATACTATTCACAGTGAGATATTACTCAG
CCGAGGAGACATAGAAAGCTCTTTCAACTTGTGGGTCCTATATCTCTGTGGTTATTTTAT
TCTTCGGACCTTCTAACTTTTCCTACCTTAGATCACCTACTACTTTCCCTGAGGACAAAA
TTGTTCTTACAGTTTACACCATCATTGTTCTTGTGTTTATCTTCTTTATATATTATCTAA
GAAATATAGAGATGTAAATTGCATTAAAAACCATATGGCATCAAAGATATTTTCAGAAGA
GAAACATAGCTTTTTTATAATATGTTAAATAAATGCATATAGTACAAGAAGAAATAC


Conceptual translation

MFC*FCYFAIMSGNLLI/LLRYSFLFNQPTYHFLSH\SSMDIF*ASSVTSKLI*NLLV
RK\NLTFTNCI*HVF/HHFCRIIEDLILGVMTFDHCMTICRLLHDMVIISR\RCHVL
T*FYWVGVAEHSFSQCCLIVCLLFCGPIEIDNYYCDTCPLLNIASTGTYFNRVLIVANSE
MVVFVILALCFVSYVVILFTVRYYSAEET*KALSTCGSYISVVILFFGPSNFSYLRSPTT
FPEDKIVLTVYTIIVLVFIFFIYYLRNIEM*IALKTIWHQRYFQKRNIAF