Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p25-ps Olfactory Receptor

Gene Symbol Or4p25-ps
Organism Rat
Family 4
Subfamily p
Pseudo Yes
Location chr3:76,734,200-76,735,000 (+)
Aliases Olr632-ps

Sequence information


Conceptual translation

MTICRLLHDMVFIS\PRCHALTRSYWVVGWKHSF/SVLFNSLFFCDPIEIDHYYSIIF
PLLNIASTDTYFTRVFIVANLEVVDFGILVLLFHSYVVILFTLRNYSAEERQKALSTYGS
HISVVILFFEPSIFSYLIP/YHFP*GQNVPAVYTIIVPVFTFFIYDLRNIEMEIAIKTI