Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4p7 Olfactory Receptor

Gene Symbol Or4p7
Organism Mouse
Family 4
Subfamily p
Pseudo No
Location chr2:88391249-88392217 (+)
Aliases Olfr1178, RP23-195I21.1, MOR225-6P, RP23-195I21.1, MOR225-6P

Sequence information


Nucleotide sequence

ATGGACTATAGGACAAATATCACAGAATTTATTCTCCTAGGGCTTTCTCAGACAAAAGAA
ATAGAAGTTATCTGCTTTGTATTATTTTTACTTTGTTACATTGCAATTTTATTTGGGAAC
CTACTTATCATGATTTCTGTCACATGGAGTCACCTCATCAATCAGCCTATGTATTTCTTT
CTGAGTTACCTTGCACTTTCAGATTTGTGTTACACCTCCACGGTGACACCCAAGCTGATT
ATCAACTTAGTCACAACAAAAAAGTCGATTTCCTACAATGGTTGCATGACGCAGCTCTTC
ACTATGCACTTCTTTGGTGGCATTGAGGTCTTTATCCTTACAGGAATGGCTTATGACCGC
TATGTGGCCATCTGCAAGCCCTTGCACTACACCATCCTTATGAGCAGGCAGAAGTGTGAT
GCTGTGATTGCAGCTTCCTGTGCTGGGGGATTTCTGCATTCCTTTGGTCAATTTCTCCTG
GCAGTCTTCTTACCCTACTGTGGCCCCAATGAAATAGATCACTACTTCTGTGATGTGTAC
CCTCTGCTTAAACTGGCCTGTACTGACACCAGAAAAATTGGTTTCTTGGTCATTGCTAAC
TCTGGCCTAATGGGCTTAGTGACTTTTGTGGTCTTGTTGATATCATATGGTGTGATCTTA
TACACTGTCAGGTCTTACTCTGCAGAGAATCGTCGCAAAGCTCTTTCCACATGCAGTTCA
CACATCACTGTGGTAGTCCTTTTCTTTGCTCCTCTATTGTTTATTTACATTCGACCAGCA
ACTACATTACCAGAAGACAAAGTATTTGCTCTCTTTTATACTATCATTGCCCCCATGCTC
AACCCCCTGATTTATACACTCAGAAACAAGGAGATGAAGAATGCCATCAAGAGACTATGT
TACCTTATGTCAGGGAGTGAAGGAAACAGGCTGAAGGGTGTCACTGTTTTCCACCATCAC
ACAGTTTCT


Conceptual translation

MDYRTNITEFILLGLSQTKEIEVICFVLFLLCYIAILFGNLLIMISVTWSHLINQPMYFF
LSYLALSDLCYTSTVTPKLIINLVTTKKSISYNGCMTQLFTMHFFGGIEVFILTGMAYDR
YVAICKPLHYTILMSRQKCDAVIAASCAGGFLHSFGQFLLAVFLPYCGPNEIDHYFCDVY
PLLKLACTDTRKIGFLVIANSGLMGLVTFVVLLISYGVILYTVRSYSAENRRKALSTCSS
HITVVVLFFAPLLFIYIRPATTLPEDKVFALFYTIIAPMLNPLIYTLRNKEMKNAIKRLC
YLMSGSEGNRLKGVTVFHHHTVS