Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p7 Olfactory Receptor

Gene Symbol Or4p7
Organism Rat
Family 4
Subfamily p
Pseudo No
Location chr3:76468294-76469262 (+)
Aliases Olr619, Olr619

Sequence information


Nucleotide sequence

ATGGACTATAGGACTAATATCACAGAATTTCTTCTCCTAGGATTTTCTCAGACAAAAGAA
ATACAAATTATCTGCTTTGTATTATTTTTACTTTGTTACATTGCAATTTTATTTGGGAAC
CTACTTATCATTATTTCTGTTACATGTAGTCACCTTCTCAACCAGCCTATGTATTTCTTT
CTGAGTTACCTTGCACTTTCTGACTTGTGCTACACCTCCACTGTGACACCGAACCTGATT
AAAAACTTAGTAGCAACAAGAAAGTCAATTTCCTACAATGGTTGCATGACACAGCTCTTC
ACTATGCACTTCTTTGGGGGCATTGAGGTCTTTATTCTCACAGGAATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCCCTGCACTACACCATCATCATGAACAGGCAGAAGTGTGAT
GCTGTAATTGTTGCTTCCTGCGCTGGGGGATTTCTGCATTCCTTCGGTCAGTTTCTCCTG
GCAGTGTTCTTACCCTACTGTGGACCCAATGTAATAGATCACTATTTCTGTGATGTGTAC
CCTCTGCTCAAACTGGCTTGTACTGACACCAGAAAAATTGGTTTCTTGGTCATTGCTAAC
TCCGGCTTGATGGGCTTAGTGACTTTCTTGGTCTTGTTGATATCATATGCTGTGATCTTA
TACACTGTTAGGTCTTACTCTACAGAAAATCGTCGCAAAGCTCTTTCCACTTGCAGTTCA
CACGTCACCGTGGTAGTCCTTTTCTTTGCTCCTCTACTGTTTATTTACATTCGACCAGCA
ACTACATTACCAGAAGACAAAGTATTTGCTCTCTTTTATACTATCATCGCTCCCATGCTC
AACCCCCTCATTTATACACTCAGAAACAAGGAGATGAAGAATGCCATCAAGAGACTATGT
TACCATATAACAGGAAGTGAAGGAAGCAGGATGAATGGCTTCACTGTTTTCCACCATCAC
ACAGTTTCT


Conceptual translation

MDYRTNITEFLLLGFSQTKEIQIICFVLFLLCYIAILFGNLLIIISVTCSHLLNQPMYFF
LSYLALSDLCYTSTVTPNLIKNLVATRKSISYNGCMTQLFTMHFFGGIEVFILTGMAYDR
YVAICKPLHYTIIMNRQKCDAVIVASCAGGFLHSFGQFLLAVFLPYCGPNVIDHYFCDVY
PLLKLACTDTRKIGFLVIANSGLMGLVTFLVLLISYAVILYTVRSYSTENRRKALSTCSS
HVTVVVLFFAPLLFIYIRPATTLPEDKVFALFYTIIAPMLNPLIYTLRNKEMKNAIKRLC
YHITGSEGSRMNGFTVFHHHTVS