Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4p8 Olfactory Receptor

Gene Symbol Or4p8
Organism Mouse
Family 4
Subfamily p
Pseudo No
Location chr2:88896672-88897595 (-)
Aliases Olfr1208, RP23-260B13.1, MOR225-4, RP23-260B13.1, MOR225-4

Sequence information


Nucleotide sequence

ATGGGATATGGAAACCTTACAGAATTTATCTTACTGGGACTTTTCCATAATGAGGATGTC
AAGGCAATATGTGCTGTGTTGTTCTTGCTTTGCTATCTTGCAATTCTCTGTGGAAACCTG
GTTGTTCTTCTTACTATCAAGGGCAGTCAACTTAGTGAGCAGCCAATGTATTTTTTTCTC
AGCTATCTGTCCTTCATGGATGTTTGCTTCACTTCCACAGTAGCCCCAAAATTTATTATA
GGCCTATTGGTACAATGTAACACAATCTCCTACAATGGCTGCATAGCCCAGATGTTTTAT
GCACACTTCTTTGGTGCCACTGAGATATTCATCTTGGTGGTAATGGCCTATGATCGGTAT
GTAGCTATTTGCAGACCCCTTTACTACATGATCACCATGAGCAGACAGGTATGTTACATC
CTTGTGATAGGCTCAGTTTTTGGTGCTTTTATACACTCACTTGTGCATGTACTGGTTATT
ATCAGACTTCCCTTTTGTGGCAGCAATGAAATAGACCACTACTTCTGTGACATATTCCCC
CTGCTGAAGCTGGCCTGTACTGACACAAGACTCCTGGTTATTGTAATCATTACTACCACA
GGGGTGATGTCCATTCTGACCTTTGTTGCATTGGTCATTTCTTACATCATCATTTTGTCC
ATCTTGAGGACCAGGTCATCAGAGAGCCGCCGCAAAGCTCTTTCTACCTGTGGCTCACAC
ATCACCGTTGTATTCATGTTCTTCTTGCCACTCATCTTTACCTATGTCCCAATGGGTGAT
TCTGTTGGGGACGACAAGGTGTTTGCTCTGTTTTACACCATGATTGCCCCATTGTTCAAC
CCTCTCATCTACACACTGAGGAATACAGACATGAAGAATGCCATGAGGAAGGTGTGGTGC
CAAGACAAACTCTTTGAAGGAAAG


Conceptual translation

MGYGNLTEFILLGLFHNEDVKAICAVLFLLCYLAILCGNLVVLLTIKGSQLSEQPMYFFL
SYLSFMDVCFTSTVAPKFIIGLLVQCNTISYNGCIAQMFYAHFFGATEIFILVVMAYDRY
VAICRPLYYMITMSRQVCYILVIGSVFGAFIHSLVHVLVIIRLPFCGSNEIDHYFCDIFP
LLKLACTDTRLLVIVIITTTGVMSILTFVALVISYIIILSILRTRSSESRRKALSTCGSH
ITVVFMFFLPLIFTYVPMGDSVGDDKVFALFYTMIAPLFNPLIYTLRNTDMKNAMRKVWC
QDKLFEGK