Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4p8 Olfactory Receptor

Gene Symbol Or4p8
Organism Rat
Family 4
Subfamily p
Pseudo No
Location chr3:77482399-77483322 (-)
Aliases Olr661, Olr661

Sequence information


Nucleotide sequence

ATGGGATATGGGAACATCACAGAATTTATCTTACTGGGGCTTTTCCATGATGAGGATGTC
AAGGCAATATGTGCTGTGTTATTCTTACTATGCTATCTTGCAATTCTCTGTGGAAACTTG
ATTGTTCTTCTCACTATCAAGGGCAGTCAGCTTAGTGAGCAGCCGATGTACTTTTTTCTC
AGCTATCTGTCTTTCATGGATGTCTGCTTCACTTCCACAGTAGCCCCAAAATTTATTATA
GGACTATTGGTACAATGTAACACAATCTCCTACAATGCCTGCATAGCACAAATGTTTTAT
GCCCACTTCTTTGGTGCCACTGAGATATTTATATTGGTGGTCATGGCCTATGATCGCTAT
GTAGCAATTTGCAGACCTCTTTACTACATGATCACGATGAGCAGACAGGTATGCTACATT
CTTGTGATAGGCTCAGTTTTTGGTGCTTTTATACACTCACTTGTGCATGTATTAGTTATT
ATCAGACTTCCTTTTTGTGGCACCAATGAAATAGACCACTACTTCTGTGACATATTCCCT
CTGCTGAAGCTGGCCTGCACTGAGACAAGACTCCTTGTTATTGTAATCATTACCACTACA
GGGGTGATGTCCATTTTGACTTTTGTTGCATTGGTAATTTCTTACATCATCATTTTGTCC
ATCTTGAGGACCAGGTCATCGGAAGGCCGTCGCAAAGCTCTTTCTACCTGTGGCTCACAT
ATCACCGTAGTGTTCATGTTCTTCTTGCCACTCATCTTTACCTATGTTCCAATGGGTGAT
TCTGTTGGGGATGACAAGGTGTTTGCTCTGTTTTACACCATGATTGCACCATTGTTCAAC
CCTCTCATCTACACACTGAGGAATACAGACATGAAGAATGCCATGAGGAAGGTGTGGTGC
CAAGACAAACTGTTTGAAGGAAAG


Conceptual translation

MGYGNITEFILLGLFHDEDVKAICAVLFLLCYLAILCGNLIVLLTIKGSQLSEQPMYFFL
SYLSFMDVCFTSTVAPKFIIGLLVQCNTISYNACIAQMFYAHFFGATEIFILVVMAYDRY
VAICRPLYYMITMSRQVCYILVIGSVFGAFIHSLVHVLVIIRLPFCGTNEIDHYFCDIFP
LLKLACTETRLLVIVIITTTGVMSILTFVALVISYIIILSILRTRSSEGRRKALSTCGSH
ITVVFMFFLPLIFTYVPMGDSVGDDKVFALFYTMIAPLFNPLIYTLRNTDMKNAMRKVWC
QDKLFEGK