Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4s2 Olfactory Receptor

Gene Symbol Or4s2
Organism Rat
Family 4
Subfamily s
Pseudo No
Location chr3:77072389-77073342 (+)
Aliases Olr649, Olr649

Sequence information


Nucleotide sequence

ATGGCCTCAAGGACTTATTCCATGGAAGAAGTAAACAATGTCACTGAATTCATTTTCTGG
GGTCTTTCTCAGAACCCACAGGTTGAAGAAGTATGCTTTGTTGTGTTTTCCTTCTTTTAC
ATCATCATTTTGCTGGGAAATGTCCTCATCATGTTGACAGTTTGCACTGGCAGTCTTTTC
AAGTCCCCCATGTATTTTTTTCTCAACTTTCTATCTTTTGTGGATATTTGCTACTCCTCA
GTCACAGCACCCAAGATGATTGTTGACCTGTTAGTGAAAAAAAAGACTATATCCTATGTG
GGGTGCATGTTACAACTCTTCGGCGTTCATTTCTTTGGTTGCACTGAGATCTTTATTCTT
ACTGTCATGGCCTATGATAGATATGTGGCCATCTGTAAACCCCTCCACTATATGACTATT
ATGGACAGAGAAAGATGCAATAAGATGTTGCTGGGAACATGGGTGGGTGGTTTCTTCCAT
TCTATTATCCAAGTGGCTCTGGTGGTCCAGCTTCCCTTTTGTGGACCCAATGAGATTGAT
CATTATTTCTGTGATGTTCACCCTGTACTGAAACTTGCCTGCACAGACACCTACACTGTT
GGTGTCGTTGTGACAGCCAACAGTGGTACCATTGCATTGGGCAGTTTTGTGATCTTGCTG
ATCTCCTATACAGTCATTCTCATGTCTCTGAGAAAGCAGTCATCAGAAGGGAGGCGCAAA
GCTCTATCCACTTGTGGATCTCACATTGCTGTTGTCATCATTTTTTTTGGGCCCTGTACT
TTCATGTATATGCGACCTGACACTACCTTCTCTGAGGACAAGATGGTAGCTATATTTTAC
ACCATTATCACCCCCATGCTGAATCCTCTGATTTACACTCTAAGAAATGCAGAAGTAAAG
AATGCAATGAGAAAACTGTGGACTAGAAAGGTTTCCTGGGACACTATTGGGAAA


Conceptual translation

MASRTYSMEEVNNVTEFIFWGLSQNPQVEEVCFVVFSFFYIIILLGNVLIMLTVCTGSLF
KSPMYFFLNFLSFVDICYSSVTAPKMIVDLLVKKKTISYVGCMLQLFGVHFFGCTEIFIL
TVMAYDRYVAICKPLHYMTIMDRERCNKMLLGTWVGGFFHSIIQVALVVQLPFCGPNEID
HYFCDVHPVLKLACTDTYTVGVVVTANSGTIALGSFVILLISYTVILMSLRKQSSEGRRK
ALSTCGSHIAVVIIFFGPCTFMYMRPDTTFSEDKMVAIFYTIITPMLNPLIYTLRNAEVK
NAMRKLWTRKVSWDTIGK