Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4s2b Olfactory Receptor

Gene Symbol Or4s2b
Organism Mouse
Family 4
Subfamily s
Pseudo No
Location chr2:88,677,900-88,678,800 (+)
Aliases Olfr1193

Sequence information


Nucleotide sequence

MASRTYSMEEVNNVTEFIFLGLSQNPEVEKVCFVVFSFFYMVILLGNLLIMLTVCSGNLF
KFPMYFFLNFLSFVDICYSSVTAPKMIIDLLVKKKTISYVGCMLQLFVVHFFGCTEIFIL
TVMAYDRYVAICKPLHYMTMMDRERCNKMLLGTWIGGFLHSIIQVALVVQLPFCGPNEID
HYFCDVHPVLKLACTDTYIVGIFVTANSGTIALGSFVILLISYTVILMSLRKQSSEGRRK
ALSTCGSHIAVVIIFFGPCTFMYMRPDTTFSEDKMVAIFYTIITPMLNPLIYTLRNAEVK
NAMRKLWARKFSWETTGK


Conceptual translation

MASRTYSMEEVNNVTEFIFLGLSQNPEVEKVCFVVFSFFYMVILLGNLLIMLTVCSGNLF
KFPMYFFLNFLSFVDICYSSVTAPKMIIDLLVKKKTISYVGCMLQLFVVHFFGCTEIFIL
TVMAYDRYVAICKPLHYMTMMDRERCNKMLLGTWIGGFLHSIIQVALVVQLPFCGPNEID
HYFCDVHPVLKLACTDTYIVGIFVTANSGTIALGSFVILLISYTVILMSLRKQSSEGRRK
ALSTCGSHIAVVIIFFGPCTFMYMRPDTTFSEDKMVAIFYTIITPMLNPLIYTLRNAEVK
NAMRKLWARKFSWETTGK