Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4x11 Olfactory Receptor

Gene Symbol Or4x11
Organism Mouse
Family 4
Subfamily x
Pseudo No
Location chr2:90036870-90037847 (+)
Aliases Olfr1265, RP24-314D20.5, MOR228-2, RP24-314D20.5, MOR228-2

Sequence information


Nucleotide sequence

ATGAAATCTTTTTTTATTATTTCAGATCATACCACCCAAACTAGCTTCCTCATGGCTGAC
ATACACAATGTGACTGAGTTCCTTTTTCTGGGACTCTCTTCTAACAAAGAGGTGGAGATA
GTTTGCTTTGTAATATTTCTGCTCTTGTACATGGCCATTGTGCTTGGGAATCTTCTCATG
GTGGTCACTGTGGTAGCCAGCAGAAGTCTTGGATCCCCCATGTACTTCTTTCTTGGCTAC
CTCTCCTTTGTGGAGATCTGCTACTCCTCCACAACAGCTCCAAAACTCATCTTGGACCTT
CTAGCTGAAAAAAAATCCATATCTGTATGGGGCTGCATGACACAGCTTTTCTTCATGCAC
TTCTTTGGTGGCGCTGAGATATTCCTGCTCACAGTGATGGCCTATGACCGTTATGTGGCC
ATCTGCAAGCCCCTGCACTACACCAGCATTATGAACCGAAATGTGTGTGCAGTCCTCGTA
GGAACAGCATGGATAGGAGGCTTTGTGCATTCCTTTGCCCAAATACTTCTCATCTTTCCT
TTGCCCTTCTGTGGCCCCAATATCATCGATCATTATTTCTGTGACTTGCTTCCTTTGCTT
AAACTTGCCTGCTCAGACACCTTCCTTATTGGCCTACTGATTGTTGCCAATGCGGGAACT
CTGTCAGTGATCAGCTTTGTGGTCCTCTTAGCATCCTATGTGGTCATCTTGTTCCATCTA
AGAACTCAGAGTGCTGAGGGACGGCGCAAAGCTCTGTCCACCTGTGGATCCCATGTCACT
GTGGTTATATTGTTCTTTGGTCCATGTGTCTTCATCTATTTGAGGCCTTCTGATACCCTA
CCTGTAGACAAGATGATAGCTGTGTTCTACACAGTGATAACTCCCCTGCTCAATCCTCTC
ATCTACTCCCTGAGAAATGCAAAAGTGAAGAAAACCATGAAGAGTCTATGGTTCAGGACA
ATGAAAGTAGATGAGAAA


Conceptual translation

MKSFFIISDHTTQTSFLMADIHNVTEFLFLGLSSNKEVEIVCFVIFLLLYMAIVLGNLLM
VVTVVASRSLGSPMYFFLGYLSFVEICYSSTTAPKLILDLLAEKKSISVWGCMTQLFFMH
FFGGAEIFLLTVMAYDRYVAICKPLHYTSIMNRNVCAVLVGTAWIGGFVHSFAQILLIFP
LPFCGPNIIDHYFCDLLPLLKLACSDTFLIGLLIVANAGTLSVISFVVLLASYVVILFHL
RTQSAEGRRKALSTCGSHVTVVILFFGPCVFIYLRPSDTLPVDKMIAVFYTVITPLLNPL
IYSLRNAKVKKTMKSLWFRTMKVDEK