Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4x11 Olfactory Receptor

Gene Symbol Or4x11
Organism Rat
Family 4
Subfamily x
Pseudo No
Location chr3:78973705-78974631 (-)
Aliases Olr733, Olr733

Sequence information


Nucleotide sequence

ATGGCTGACCTATTCAATGTGACTGAGTTCATTTTCCTGGGACTCTCTCCCAATAAAGAG
GTGCAGAGAGTTTGCTTTGTGCTATTTCTGCTCTTGTACATGGCCATTGTGCTTGGGAAT
CTTCTTATGGTGGTCACTGTGGCAGTCAGCAGAAATCTTGGATCCCCAATGTACTTCTTC
CTCAGCTCCCTCTCCTTTGTGGAGATCTGTTATTCCTCCACGACAGCCCCCAAACTCATC
TTGGATCTCCTTGCTGAAAAGAAATCCATATCTGTGTGGGGCTGCATGACACAGCTTTTC
TTCCTCCACTACTTTGGTGGCATTGAGATTTTCCTGCTCACAGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCCCTGCACTACACCAGCATCATGAACCGAAAGGTGTGTATA
GTCCTTGTGGGAACAGCATGGACGGGAGGATTTGTGCATTCTTTTGCCCAAATAGTTCTC
ATCTTTCCTTTGCCCTTCTGTGGACCCAATACCATTGACCATTATTTTTGTGATGTGCTT
CCTCTTCTTAAACTTGCCTGCTCAGACACCTTCCTCATTGGTCTGCTGATTGTTGCCAAT
GCGGGGACACTGTCTGTGATCAGCTTTGTGGTCCTCTTAGCATCCTACGTGGTCATCTTG
TTCCACCTGAGAACTCAGAGTGCTGAGGGACGGCGCAAAGCTCTGTCCACCTGTGGGTCC
CATGTCACTGTGGTTATATTGTTCTTTGGTCCATGTGTCTTCATCTATTCGAGGCCTTCT
GATACCCTGCCTGTAGACAAGATAATAGCTGTGTTCTACACGGTGATAACCCCCCTCCTC
AATCCTCTCATCTACTCCCTGAGAAGTGCGGAAGTGAAGAAAGCCATGAAGGATCTATGG
TTCAGGACAATGAAAGCAGATGAGAAA


Conceptual translation

MADLFNVTEFIFLGLSPNKEVQRVCFVLFLLLYMAIVLGNLLMVVTVAVSRNLGSPMYFF
LSSLSFVEICYSSTTAPKLILDLLAEKKSISVWGCMTQLFFLHYFGGIEIFLLTVMAYDR
YVAICKPLHYTSIMNRKVCIVLVGTAWTGGFVHSFAQIVLIFPLPFCGPNTIDHYFCDVL
PLLKLACSDTFLIGLLIVANAGTLSVISFVVLLASYVVILFHLRTQSAEGRRKALSTCGS
HVTVVILFFGPCVFIYSRPSDTLPVDKIIAVFYTVITPLLNPLIYSLRSAEVKKAMKDLW
FRTMKADEK