Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4x11b-ps Olfactory Receptor

Gene Symbol Or4x11b-ps
Organism Rat
Family 4
Subfamily x
Pseudo Yes
Location chr3:78934378-78935415 (+)
Aliases Olr730-ps, Olr730-ps

Sequence information


Nucleotide sequence

TTCAAAGTTTTCTGCAAAAGATTTTATTTAAATTACTAATTTCATGAATTCCTTATCTCC
TTTGTATTACTTCAGATCATACCACCCAAAGTGCTCCCTCATGACTGACACACACAATGT
GACTGAGTTCTTTTTTCTGGGACTCTCTTCTAATAGAGAGGTGGAAAGAGTTTGCTTTGT
GATATTTCTACTCTTGTACATGGCCATTATGCTTGGGAATCTTCTCATGGTGGTCACTGT
GGTAGCCAGCAGGAGTCTTGGGTCCCCCATGTACTTCTTTCTTGGCTACCTCTCCTTTGT
GGAGATCTGCTACTCCTCCACAACAGCCCCAAAACTAATCTTGGATCTCCTTGCTGAAAA
GAAATCCATATCTGTATGGGGCTGCATGACACAGCTTTTCTTCATGCACTTCTTTGGTGG
TGCTGAGATTTTCCTGCTCACAGTGATGGCCTATGACCGCTATGTGGCCATCTGCAAGCC
CCTGCACTACACCAGCATCATGAACCGAAAGGTGTGTGCAGTCCTCGTGGGAACAGCATG
GATGGGAGGCTTTGTGCATTCCTTTGCCCAAATAGTTCTCATCTTTCCTTTGCCCTTCTG
TGGACCCAATACCATTGACCATTATTTCTGTGACTTGCTTCCTCTTAGCTTCCTACGTGG
TCATCTTGTTCCATCTGAGAACTCAGAGTGCTGAGGGACGGCGCAAAGCTCTGTCCACCT
GTGGGTCCCATGTCACTGTGGTTATATTGTTCTTTGGTCCATGTGTCTTCATCTATTTGA
GGCCTTCTGATACCCTGCCTGTAGACAAGATGATAGCTGTGTTCTACACGGTGATAACCC
CCCTCCTCAATCCTCTCATCTACTCCCTGAGAAATGCAGAAGTGAAGAAGGCCATGAAGA
ATCTATGGTTCAAGACAATGGAAGTAGATGAAAAATAGAATGCGGATATTGGCTATTGGG
ATTGGAATGATGCTAAGTTCAAACTTATGGGCACTGAGGGCACGAAAGGCTCATTTAGCA
TTATTGTAGCTGATAAAT


Conceptual translation

MTDTHNVTEFFFLGLSSNREVERVCFVIFLLLYMAIMLGNLLMVVTVVASRSLGSPMYFF
LGYLSFVEICYSSTTAPKLILDLLAEKKSISVWGCMTQLFFMHFFGGAEIFLLTVMAYDR
YVAICKPLHYTSIMNRKVCAVLVGTAWMGGFVHSFAQIVLIFPLPFCGPNTIDHYFCDLL
\LASYVVILFHLRTQSAEGRRKALSTCGSHVTVVILFFGPCVFIYLRPSDTLPVDKMIA
VFYTVITPLLNPLIYSLRNAEVKKAMKNLWFKTMEVDEK