Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4x11c Olfactory Receptor

Gene Symbol Or4x11c
Organism Rat
Family 4
Subfamily x
Pseudo No
Location chr3:78982730-78983659 (-)
Aliases Olr734, Olr734

Sequence information


Nucleotide sequence

ATGGCTGACCTATTCAATGTGACTGAGTTCATTTTCCTGGGACTCTCTCCCAATAAAGAG
GTGCAGAGAGTTTGCTTTGTGCTATTTCTGCTCTTGTACATGGCCATTGTGCTTGGGAAT
CTTCTTATGGTGGTCACTGTGGCAGTCAGCAGAAATCTTGGATCCCCAATGTACTTCTTC
CTCAGCTCCCTCTCCTTTGTGGAGATCTGTTATTCCTCCACGACAGCCCCCAAACTCATC
TTGGATCTCCTAGCTGAAATGAAATCCATATCTGTGTGGGGCTGCATGACACAGCTTTTC
TTCCTCCACTACTTTGGTGGCATTGAGATTTTCCTGCTCACAGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCCCTGCACTACACCAGCATCATGAACCGAAAGGTGTGTATA
GTCCTTGTGGGAACAGCATGGACGGGAGGATTTGTGCATTCTTTTGCCCAAATAGTTCTC
ATCTTTCCTTTGCCCTTCTGTGGACCCAATACCATTGACCATTATTTTTGTGATGTGCTT
CCTCTTCTTAAACTTGCCTGCTCAGACACCTTCCTCATTGGTCTGCTGATTGTTGCCAAT
GCGGGAACACTGTCTGTGATCATTTTTGTGGTCCTCTTAGCATCCTACGTGGTCATCTTG
TTCCACCTGAGAACTCTGAGTGCTGAGGGACGGCGCAAAGCTCTGTCCACCTGTGGGTCC
CATGTCACTGTGGTTATATTGTTTTTTGGTCCATGTGTCTTCATCTATTCGAGGCGTTCT
GATACCCTGCCTGTAGACAAGATGATAGCTGTGTTCTACACGGTGATAACCCCCCTCCTC
AATCCTCTCATCTACTCCCTGAGAAGTGCGGAAGTGAAGAAAGCCATGAAGAATCTATGG
TTCAGGACTATGAAAGCAGATGAGAAATAG


Conceptual translation

MADLFNVTEFIFLGLSPNKEVQRVCFVLFLLLYMAIVLGNLLMVVTVAVSRNLGSPMYFF
LSSLSFVEICYSSTTAPKLILDLLAEMKSISVWGCMTQLFFLHYFGGIEIFLLTVMAYDR
YVAICKPLHYTSIMNRKVCIVLVGTAWTGGFVHSFAQIVLIFPLPFCGPNTIDHYFCDVL
PLLKLACSDTFLIGLLIVANAGTLSVIIFVVLLASYVVILFHLRTLSAEGRRKALSTCGS
HVTVVILFFGPCVFIYSRRSDTLPVDKMIAVFYTVITPLLNPLIYSLRSAEVKKAMKNLW
FRTMKADE