Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4x12-ps Olfactory Receptor

Gene Symbol Or4x12-ps
Organism Mouse
Family 4
Subfamily x
Pseudo Yes
Location chr2:90085533-90086459 (-)
Aliases Olfr1267-ps1, MOR228-1, MOR228-1

Sequence information


Nucleotide sequence

ATGGCTGACATACACAATGTGACTGAGTTCCTTTTTCTGGGACTCTCTCCCAATCAAGAG
GTGCAGAGAGTTTGCTTTGTGCTATTTCTGCTCTTGTACATGGCCATTGTGCTTGGGAAT
CTTCTCATGGTGGTCACTGTGGTAGCCAGCAGAAATCTTGGATCCCCAATGTACTTCTTT
CTTGACTCTCTCTCCTTTGTGGAGATCTGATACTCCTCCATGACAGCCACAAAACTCATC
TTGGATCTCCTAACTGAAAAGAAATCCATATCTGTATGGGGCTGCATGATACAGCTTTTC
TTTATCCACTTCGTTGGTGCTGCTGAGATTTTCCTGCTCACAATGATGGCCTATGACTGC
TATGTGGCCATCTGCAAGCCCCTGCACTACACCAGCATCATGAACCAAAGTGTGTGTGCA
GTCCTCCTGGGAACAGCATGGATGGGAGGCTTTGTGCATTGTCTTGCCCAGATCCTTCTC
CTTCTTCCTTTGCCCTTCTGTGGCCCCAATGTCATTGACCATTATTTCTGTGATGTGTTC
CCTGTGCTTAAACTTGCCTGCTCAGACACCTTCCTCATTGGGCTGCTGATTGTTGCCAAT
GGGGGAACTCTGTCTGTGATCAGCTTTGTGGTCCTCTTAGCATCGTATGTGGTCATCTTT
TTCTATCTGAGAACCCAGAGTGCTGAGGGATGGCGCAAAACTTTGGCCACCTGTGGGTGC
CATGTCACTGTGGTTATATTGTTCTTTGGTCCATGTGTCTTCATCTATTTGAGGCCTTCT
GATACCCTACCTGTAGACAAGATGATAGCTGTGTTCTACACAGTGATAACTCCCCTGCTC
AATCCTCTCATCTACTCCCTGAGAAATGCAGAAGTGAAGAAAACCATGAAGTGTCTATGG
TTCAGGACAATGAAAGTAGATGAGAAA


Conceptual translation

MADIHNVTEFLFLGLSPNQEVQRVCFVLFLLLYMAIVLGNLLMVVTVVASRNLGSPMYFF
LDSLSFVEI*YSSMTATKLILDLLTEKKSISVWGCMIQLFFIHFVGAAEIFLLTMMAYDC
YVAICKPLHYTSIMNQSVCAVLLGTAWMGGFVHCLAQILLLLPLPFCGPNVIDHYFCDVF
PVLKLACSDTFLIGLLIVANGGTLSVISFVVLLASYVVIFFYLRTQSAEGWRKTLATCGC
HVTVVILFFGPCVFIYLRPSDTLPVDKMIAVFYTVITPLLNPLIYSLRNAEVKKTMKCLW
FRTMKVDEK