Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4x13 Olfactory Receptor

Gene Symbol Or4x13
Organism Rat
Family 4
Subfamily x
Pseudo No
Location chr3:79187055-79187981 (+)
Aliases Olr745, Olr745

Sequence information


Nucleotide sequence

ATGGCTAATACACACAATGTGACTGAGTTCATTTTCCTGGGACTCTCTCCCAATAAAGAG
GTGCAGAGAGTTTGCTTTGTGCTATTTCTGCTCCTGTACATGGCCATTGTGCTTGGGAAT
CTTCTCATGGTGGTCATTGTGGCAGCCAGCAGAAATCTTGGATCCCCAATGTACTACTTC
CTCAGCTCCCTCTCCTTTGTGGAGATCTGTTATTCCTCCACGACAGCCCCCAAACTCATC
TTGGATCTCCTAGCTGAAAAGAAATCCATATCTGTGTGGGGCTGCATGACACAGCTTTTC
TTCATGCACTTCTTTGGTGGCATTGAGATGTTCCTGCTCACAGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCCCTGCACTACACCAGCATCATGAACCGGCAGGTGTGTGCA
GTCCTCGTGGGAACAGCATGGACGGGAGGCTTTGTGCATTCCCTTGCCCAGGTCCTTCTC
ATCTTCCGCTTGCCCTTCTGTGGCCCCAATGTCATTGACCATTATTTTTGTGATGTGCTT
CCTGTGCTTAAACTTGCCTGCTCAGACACCTTCCTCATTGGTCTGCTGATTGTTGTCAAT
GGAGGGACACTGTCTGTGATCAGCTTTGTGGTCCTCTTAGCATCCTACGTGGTCATCTTG
TTCCACCTGAGAACTCAGAGTGCTGAGGGACGGCGCAAAGCTCTGTCCACCTGTGGGTCC
CATGTCACTGTGGTTGTTATATTTTTCGCACCCTGTGTCTTCATCTATCTGAGACCGACA
GCCACTCTTCCTATAGATAAAATGGTAACTGTGTTCTACACGGTGATAACTCCCCTCCTC
AACCCTATCATCTATTCCCTGAGAAATGCAGAGGTGAAGAAAGCCATGAAGACTCTATGG
ATCAGGACAACAAAAGTAGATAAAAAA


Conceptual translation

MANTHNVTEFIFLGLSPNKEVQRVCFVLFLLLYMAIVLGNLLMVVIVAASRNLGSPMYYF
LSSLSFVEICYSSTTAPKLILDLLAEKKSISVWGCMTQLFFMHFFGGIEMFLLTVMAYDR
YVAICKPLHYTSIMNRQVCAVLVGTAWTGGFVHSLAQVLLIFRLPFCGPNVIDHYFCDVL
PVLKLACSDTFLIGLLIVVNGGTLSVISFVVLLASYVVILFHLRTQSAEGRRKALSTCGS
HVTVVVIFFAPCVFIYLRPTATLPIDKMVTVFYTVITPLLNPIIYSLRNAEVKKAMKTLW
IRTTKVDKK