Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4x14 Olfactory Receptor

Gene Symbol Or4x14
Organism Mouse
Family 4
Subfamily x
Pseudo No
Location chr2:90,221,600-90,222,600 (-)
Aliases Olfr1506

Sequence information


Nucleotide sequence

MSPSSFFMLLTPRLLYYFRSQHPNCSPMADIHNVTEFFFLGLSSNQEVQRVCFVIFLFLY
MAIVLGNLLMVVIVAVSRNLGSPMYFFLSSLSFVEICYSSTTAPKLIVDLLAEKKSISVW
GCMAQLFFMHFFGGIEMFLLMMMAYDRYVAICKPLHYTSIMNRQVCTVLVGMAWMGGFVH
SLAQVLLIFRLPFCGPNIIDHYFCDVLPVLKLVCSDTFLIGLLIVVNGGTLTVISFVVLL
SSYAVILFHLRTQSAEGRRKALSTCGSHVTVVVIFFAPCVFIYLRPTATLPIDKMVTVFY
TVITPLLNPIIYSLRNAEVKKVIKILCTRATKVDKK


Conceptual translation

MSPSSFFMLLTPRLLYYFRSQHPNCSPMADIHNVTEFFFLGLSSNQEVQRVCFVIFLFLY
MAIVLGNLLMVVIVAVSRNLGSPMYFFLSSLSFVEICYSSTTAPKLIVDLLAEKKSISVW
GCMAQLFFMHFFGGIEMFLLMMMAYDRYVAICKPLHYTSIMNRQVCTVLVGMAWMGGFVH
SLAQVLLIFRLPFCGPNIIDHYFCDVLPVLKLVCSDTFLIGLLIVVNGGTLTVISFVVLL
SSYAVILFHLRTQSAEGRRKALSTCGSHVTVVVIFFAPCVFIYLRPTATLPIDKMVTVFY
TVITPLLNPIIYSLRNAEVKKVIKILCTRATKVDKK