Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4x5-ps Olfactory Receptor

Gene Symbol Or4x5-ps
Organism Mouse
Family 4
Subfamily x
Pseudo Yes
Location chr2:90,110,500-90,111,400 (-)
Aliases Olfr1268-ps1

Sequence information


Nucleotide sequence

MAAASNVTEIIFLGLSQYQHVQKVIFVMFLLMYTAIVLGNGLIVVTIVASKGLSSPMYFF
LGYLSFVEVCYCSVTAPKLIFDSLLQRKAISLQGCITQIFFLHFFGGTEIFLLTVMAYDR
YVAICKPLHYVTIMNRRVCGLLVGAAWSGGLLHSAGQTFLIFQLPFCGPNIINHYFCDVH
PVLKLACSDTFLISLLVIINGGSISVISFAVLLASYVVILNSLRSHTAEGRHKALSTCAS
HLAVVGL/FFIPCSFVYMRPCITFPVDKVVAVFYTVVTPLLNPIIYSFRNTEVKNAMKRL
VGRKVTW


Conceptual translation

MAAASNVTEIIFLGLSQYQHVQKVIFVMFLLMYTAIVLGNGLIVVTIVASKGLSSPMYFF
LGYLSFVEVCYCSVTAPKLIFDSLLQRKAISLQGCITQIFFLHFFGGTEIFLLTVMAYDR
YVAICKPLHYVTIMNRRVCGLLVGAAWSGGLLHSAGQTFLIFQLPFCGPNIINHYFCDVH
PVLKLACSDTFLISLLVIINGGSISVISFAVLLASYVVILNSLRSHTAEGRHKALSTCAS
HLAVVGL/FIPCSFVYMRPCITFPVDKVVAVFYTVVTPLLNPIIYSFRNTEVKNAMKRL
VGRKVTW