Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4x5 Olfactory Receptor

Gene Symbol Or4x5
Organism Rat
Family 4
Subfamily x
Pseudo No
Location chr3:79009437-79010363 (-)
Aliases Olr735, Olr735

Sequence information


Nucleotide sequence

ATGGCAGCTGCAAGCAATGTTACAGAAATAATTTTCTTGGGATTATCCCAGAGCCAGCAT
GTGCAGAAGGTCATTTTTGTGATGTTTCTCCTGATGTACACAGCCATTGTGTTGGGCAAT
GGCCTTATTGTGGTGACTGTCATGGCCAGCAAAGGGCTCTCTTCCCCCATGTATTTCTTC
CTCAGCTACTTGTCATTGGTAGAAGTTTGCTACTGTTCTGTCACAGCCCCTAAACTCATC
TTCGACTCTTTGCTCAAGAGGAAAGTAATTTCCCTCCAGGGTTGCATCACACAAATATTT
TTCCTTCATTTCTTTGGTGGCACTGAAATCTTCCTTCTGACAGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCCTTGCACTATGTCACTATCATGAACCGAAGAGTATGTGGC
CTCCTGGTTGGAGCAGCATGGAGTGGGGGTTTGCTGCATTCTGCTGGACAAACTTTCCTC
ATTTTCCAGCTGCCGTTTTGTGGTCCCAACGTCATTGACCACTACTTCTGCGATGTCCAC
CCAGTGTTGAAGCTGGCTTGCTCAGACACCTTCCTGATTAGCCTGCTAGTCATCATCAAT
GGTGGTTCCATCTCAGTGATCAGCTTTGCAGTGCTGTTAGTTTCTTATGTGGTCATTCTG
CATTCTCTGAGGAGCCATACAGCAGAAGGACGGTATAGGGCACTATCTACTTGTGCCTCT
CACCTGGCTGTGGTGGGTCTGTTTTTTATACCCTGCTCTTTTGTCTACATGAGACCCTGT
GTTACTCTCCCTGTGGACAAGGTTGTGGCTGTGTTTTATACAGTTGTCACACCTCTCTTG
AACCCCATTATTTACTCTTTCAGAAACACTGAGGTAAAAAATGCCATGAGAAGACTTGTG
GGGAGGAAGGTGACTTGGGAAGAGAAA


Conceptual translation

MAAASNVTEIIFLGLSQSQHVQKVIFVMFLLMYTAIVLGNGLIVVTVMASKGLSSPMYFF
LSYLSLVEVCYCSVTAPKLIFDSLLKRKVISLQGCITQIFFLHFFGGTEIFLLTVMAYDR
YVAICKPLHYVTIMNRRVCGLLVGAAWSGGLLHSAGQTFLIFQLPFCGPNVIDHYFCDVH
PVLKLACSDTFLISLLVIINGGSISVISFAVLLVSYVVILHSLRSHTAEGRYRALSTCAS
HLAVVGLFFIPCSFVYMRPCVTLPVDKVVAVFYTVVTPLLNPIIYSFRNTEVKNAMRRLV
GRKVTWEEK