Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4z4 Olfactory Receptor

Gene Symbol Or4z4
Organism Mouse
Family 4
Subfamily z
Pseudo No
Location chr19:12,098,700-12,099,600 (-)
Aliases Olfr1427

Sequence information


Nucleotide sequence

MELGNHTKVTEFIFCGLTQSQELSLLLFFFLSIVYITTVLVNVTIMVTVTWESRLHTPMY
FLLRNLSVLDICFSSITVPKVLVDLLSRRKTISFNGCFTQIFFFHLLGGADIFSLSVMAF
DRYMAIFRPLHYVTIMSRGRCTALIAASWVGGFVHSIVQIFLLLPLPFCGPNVVDSFYCD
VPQVLKLACTDTFVLELLMISNNGLITTLWFVLLLVSYTVILTMLRSHTGEGRKKAISTC
TSHITVVTLHFVPCIYVYARPFTALPMDRAVSITLNIIVPVLNPMIYTLRNQEMKSAMKR
LRKRLILSEVE


Conceptual translation

MELGNHTKVTEFIFCGLTQSQELSLLLFFFLSIVYITTVLVNVTIMVTVTWESRLHTPMY
FLLRNLSVLDICFSSITVPKVLVDLLSRRKTISFNGCFTQIFFFHLLGGADIFSLSVMAF
DRYMAIFRPLHYVTIMSRGRCTALIAASWVGGFVHSIVQIFLLLPLPFCGPNVVDSFYCD
VPQVLKLACTDTFVLELLMISNNGLITTLWFVLLLVSYTVILTMLRSHTGEGRKKAISTC
TSHITVVTLHFVPCIYVYARPFTALPMDRAVSITLNIIVPVLNPMIYTLRNQEMKSAMKR
LRKRLILSEVE