Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4z7-ps Olfactory Receptor

Gene Symbol Or4z7-ps
Organism Rat
Family 4
Subfamily z
Pseudo Yes
Location chr1:228,457,000-228,458,000 (-)
Aliases Olr320-ps

Sequence information


Nucleotide sequence

AGCCGGGTGCAAGAATTTGTTTTTGAAGGACTAATGGACGCAGACCCAAGAGCTGAGTTG
GGCAACCTCCTCGTCATGGTCACTGTGACCTGGAAGTCCCAACTCCACACTCCCATGCAC
TTCCTGCTTCACAACCTCTCTGTCTTAGACATCTGCTTCTCCTCTATCACTGCTCCAAAA
GTCCTAATGGACCTTCTCTCAAGAAGACAGACCATCTCCTTAAATGGTTGCATCATGCAG
ATGTTTTTCGTCCATCTGCTTGGTGGTACAGACATTTTCTCTCTCTCTGTGATGGCATTT
GATAGATACATGGCCATCTCCAAGCCCCTGCACTATGTGACCATCATGAGTAGTAGGTGG
TGCACAGCCCTCATCGCGGCCTCCTGGGTGGGTGGCTTTGCCTACTCCATTGTGCAGATC
TCCCTCTTGTTCCCACTCCCCTTCTGTGGACCCAATGTTCTTGATACTTTCTACCGTAAT
GCCCCCACA


Conceptual translation

SRVQEFVFEGLMDADPRAELGNLLVMVTVTWKSQLHTPMHFLLHNLSVLDICFSSITAPK
VLMDLLSRRQTISLNGCIMQMFFVHLLGGTDIFSLSVMAFDRYMAISKPLHYVTIMSSRW
CTALIAASWVGGFAYSIVQISLLFPLPFCGPNVLDTFYRNAPT\LKLTCTSTF\*GLN
DFNKQLDVYAVVCLSASANLTMLKSHIGEDRRKAISTCAQMTVVTLYFVPCIYDYARPFT
ALPMDRTVSITFTITIPVLRICTLRNQEVKSVMRRLRKRLGPSKKEV