Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51a24-ps Olfactory Receptor

Gene Symbol Or51a24-ps
Organism Rat
Family 51
Subfamily a
Pseudo Yes
Location chr1:169,279,000-169,280,000 (-)
Aliases Olr146-ps

Sequence information


Conceptual translation

MGHFRINASQAPSFILTGFPGMEAMESWLSLPFLLFYAVSIVGNFLILLIIKEEQSLHQP
MYYFLSLLSVNDLGVSFSTLPTVLSALCFHARVITFNACLTQMFFYK\FSWTESGILLA
MSFDRSVAICNPLRYATVLTNARLVAMGLGTVFRSFVLIVVFPVLLHRLPFCHPQNILSH
AYCLHVDMIKLACTDVSLNSHYGLTIVLLTFGLDSALILISYVLILRSVLAIASQEERLK
TLNTCVSHILAVLIFYVPMVSVSTVHRFGAGLPHAVHILMSILYLFVPPMLNPIIYSIKT
KEIRRRLLKMLFRVKL