Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51a25 Olfactory Receptor

Gene Symbol Or51a25
Organism Mouse
Family 51
Subfamily a
Pseudo No
Location chr7:102,724,000-102,724,000 (-)
Aliases Olfr559

Sequence information


Nucleotide sequence

MIPSGPFINISFFQPQSFLMIGIPGLEFAHGWISIPFSFMYTVALTGNCLILLAVRRTHS
LHQPMYYFLSMLALSDVGLSLSTLPSTLAVLWFDYRSIDFNACLVQMFFLHSFSVVESSV
LLAMSFDRFVAISNPLRYASVLTNNVIIRIGVAIVARATLSLFPVPFLLKRLNYCPGKIL
LSHSFCFHADVMKLACADITVNILYGLYVVLSTVGVDSLLIVMSYSLILHTVMGLASPRE
RVRTLNTCVSHILAVLVFYIPVIGVSMIHRFGKHLPHIVHALVAYVYLVVPPVLNPIIYS
VKSKPIRGAMFKVLRGKD


Conceptual translation

MIPSGPFINISFFQPQSFLMIGIPGLEFAHGWISIPFSFMYTVALTGNCLILLAVRRTHS
LHQPMYYFLSMLALSDVGLSLSTLPSTLAVLWFDYRSIDFNACLVQMFFLHSFSVVESSV
LLAMSFDRFVAISNPLRYASVLTNNVIIRIGVAIVARATLSLFPVPFLLKRLNYCPGKIL
LSHSFCFHADVMKLACADITVNILYGLYVVLSTVGVDSLLIVMSYSLILHTVMGLASPRE
RVRTLNTCVSHILAVLVFYIPVIGVSMIHRFGKHLPHIVHALVAYVYLVVPPVLNPIIYS
VKSKPIRGAMFKVLRGKD