Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51a25 Olfactory Receptor

Gene Symbol Or51a25
Organism Rat
Family 51
Subfamily a
Pseudo No
Location chr1:167,892,000-167,893,000 (-)
Aliases Olr60

Sequence information


Nucleotide sequence

ATGATCTCCTCACAGGCTTTCATCAACATTTCCTTCTTCCAGCCACAGTCTTTCCTCATG
ATTGGCATCCCAGGACTAGAGGCTGTCCACGGCTGGATCTCCATCCCCTTCTCCTTCATG
TACACTGTGGCACTCACCGGAAACTGTCTCATCCTCCTGGCTGTGAGGAGGACCCATAGC
CTACACCAGCCCATGTACTACTTCCTATCCATGCTGGCCCTTAGTGATGTGGGCCTCAGC
TTGTCCACACTGCCCTCCACCCTGGCTGTGCTCTGGTTTGACTATCGCTTCATCGGCTTC
AATGCCTGTCTGATCCAGATGTTCTTCCTACACTCCTTCTCCGTGTTGGAGTCCTCAGTG
CTCTTGGCCATGTCCTTTGACCGATTTGTGGCTATCTCCAATCCACTGCGCTATGCATCT
GTCCTCACTAACACTGTCATCATCAGGATCGGGGTGGCCATTGTAGCTAGGGCCACTCTG
TCACTATTCCCAGTGCCCTTCTTGCTGAAACGACTGAACTACTGCCCTGGCAAGATCCTC
CTGTCTCACTCATTCTGTTTCCATGCTGATGTCATGAAGCTGGCCTGTGCTGACATTACT
GTCAACATCCTCTATGGACTCTATGTGGTTCTGTCCACAGTGGGTGTAGACTCCTCGCTT
ATTGTCATGTCCTACTCCTTGATTCTTTACACAGTGATGGGGCTAGCCTCTCCAAGGGAG
CGCGTCCGCACCCTCAACACATGTGTTTCCCATATCTTGGCTGTCCTGGTCTTTTACATT
CCAGTCATAGGTGTGTCCATGATCCACCGTTTTGGAAAGCACCTACCTCACATTGTTCAT
GCCCTTGTTGCGTACGTGTACCTTGTGGTACCTCCTGTGCTCAACCCCATCATCTATAGT
GTCAAGTCCAAGCCCATCAGGGGAGCCATGTTCAGAGTTCTAAGAGGAAAAGACCAGACC


Conceptual translation

MISSQAFINISFFQPQSFLMIGIPGLEAVHGWISIPFSFMYTVALTGNCLILLAVRRTHS
LHQPMYYFLSMLALSDVGLSLSTLPSTLAVLWFDYRFIGFNACLIQMFFLHSFSVLESSV
LLAMSFDRFVAISNPLRYASVLTNTVIIRIGVAIVARATLSLFPVPFLLKRLNYCPGKIL
LSHSFCFHADVMKLACADITVNILYGLYVVLSTVGVDSSLIVMSYSLILYTVMGLASPRE
RVRTLNTCVSHILAVLVFYIPVIGVSMIHRFGKHLPHIVHALVAYVYLVVPPVLNPIIYS
VKSKPIRGAMFRVLRGKDQT