Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51a25b-ps Olfactory Receptor

Gene Symbol Or51a25b-ps
Organism Rat
Family 51
Subfamily a
Pseudo Yes
Location chr1:167883728-167884690 (-)
Aliases Olr61

Sequence information


Nucleotide sequence

ATGATCTCCTCACAGGCTTTCATCAACATTTCCTTCTTCCAGCCACAGTCTTTCCTAATG
ACTGGTATCCCAGGACTAGAGGCTGTCCACGGCTGGATCTCCATCCCCTTCTCCTTCATG
TACACTGTGGCACTCACCGGAAACTGTCTCATCCTCCTGGCTGTGAGGAGGACCCATAGC
CTACACCAGCCCATGTACTACTTCCTATCCATGCTGGCCCTTAGTGATGTGGGCCTCAGC
TTGTCCACACTGCCCTCCACCCTGGCTGTGCTCTGGTTTGACTATCGCTTCATCGGCTTC
AATGCCTGTCTGATCCAGATGTTCTTCCTACACTCCTTCTCCGTGTTGGAGTCCTCAGTG
CTCTTGGCCATGTCCTTTGACCGATTTGTGGCTATCTCCAATCCACTGCGCTATGCATCT
GTCCTCACTAACACTGTCATCATCAGGATCGGGGTGGCCATTGTAGCTAGGGCCACTCTG
TCACTTTTCCCAGGGCCCTTCTTGCTGAAACGACTGAACTACTGCCCTGGCAAGATCCTC
CTGTCTCACTCATTCTGTTTCCATGCTGATGTCATGAAGCTGGCCTGTGCTGACATTACT
GTCAACATCCTCTATGGACTCTATGTGGTTCTGTCCACAGTGGGTGTAGACTCCTTGCTT
ATTGTCATGTCCTACTCCTTGATTCTTTACACAGTGATGGGGCTAGCCTCTCCAAGGGAG
CGCGTCCGCACCCTCAACACATGTGTTTCCCATATCTTGGCTGTCCTGGTCTTTTACATT
CCAGTCATAGGTGTGTCCATGATCCACCGTTTTGGAAAGCACCTACCTCACATTGTTCAT
GCCCTTGTTGCGTACGTGTACCTTGTGGTACCTCCTGTGCTCAACCCCATCATCTATAGT
GTCAAGTCCAAGCCCATCAGGGGAGCCATGTTCAGAGTTCTAAGAGGAAAAGACCAGACC
TGA


Conceptual translation

ISSQAFINISFFQPQSFLMTGIPGLEAVHGWISIPFSFMYTVALTGNCLILLAVRRTHSL
HQPMYYFLSMLALSDVGLSLSTLPSTLAVLWFDYRFIGFNACLIQMFFLHSFSVLESSVL
LAMSFDRFVAISNPLRYASVLTNTVIIRIGVAIVARATLSLFPGPFLLKRLNYCPGKILL
SHSFCFHADVMKLACADITVNILYGLYVVLSTVGVDSLLIVMSYSLILYTVMGLASPRER
VRTLNTCVSHILAVLVFYIPVIGVSMIHRFGKHLPHIVHALVAYVYLVVPPVLNPIIYSV
KSKPIRGAMFRVLRGKDQT