Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51a42 Olfactory Receptor

Gene Symbol Or51a42
Organism Mouse
Family 51
Subfamily a
Pseudo No
Location chr7:104,059,000-104,060,000 (-)
Aliases Olfr643

Sequence information


Nucleotide sequence

MGGEAHNSSGLPPFILTGLPGMETSQHWLFLLLGVLYTVSIVGNALILFIIKEEESLHQP
MYYFLSLLSLNDLGVSFSTLTTVLGVFCFLLREISFNSCMSQMFFIHLFSFMESGILLAM
SFDRYVAICNPLHYSTVLTDARVMWMGVCVFFRSFCMIFPLPFLLKRLPFCKANVLSHAY
CLHPDMIRLPCGDITINNIFGLFIVISTFGLDSALILLSYVLILRSVLAIASREERLKTL
NTCVSHLCAVLIFYVPMVGVSMAARYGRHAPRYVHTLLSLVYLFVPPMLNPVIYSIKTKE
IRRRLHKILLGTKI


Conceptual translation

MGGEAHNSSGLPPFILTGLPGMETSQHWLFLLLGVLYTVSIVGNALILFIIKEEESLHQP
MYYFLSLLSLNDLGVSFSTLTTVLGVFCFLLREISFNSCMSQMFFIHLFSFMESGILLAM
SFDRYVAICNPLHYSTVLTDARVMWMGVCVFFRSFCMIFPLPFLLKRLPFCKANVLSHAY
CLHPDMIRLPCGDITINNIFGLFIVISTFGLDSALILLSYVLILRSVLAIASREERLKTL
NTCVSHLCAVLIFYVPMVGVSMAARYGRHAPRYVHTLLSLVYLFVPPMLNPVIYSIKTKE
IRRRLHKILLGTKI