Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or51a42 Olfactory Receptor

Gene Symbol Or51a42
Organism Rat
Family 51
Subfamily a
Pseudo No
Location chr1:169,269,000-169,270,000 (-)
Aliases Olr145

Sequence information


Nucleotide sequence

ATGAGAGGGGAAGCCCAGAACAGCTCTGGGTTGCCTCCCTTCATCCTGACAGGACTGCCA
GGGCTGGAGACCTCCCAGCACTGGTTGTTCCTGCTCCTTGGTGTCCTCTACACTGTCTCC
ATAGTGGGCAATGCCCTGATCCTTTTCATCATCAAGGAGGAAGAGAGTCTACACCAGCCC
ATGTACTACTTCCTGTCTCTGCTCTCAGTCAATGACCTGGGTGTGTCTTTCTCCACACTG
CCCACTGTCCTGGCTGTGTTTTGCTTCCACTTAAGAGAGATCAGTTTTAATTCTTGCATG
TCCCAAATGTTCTTTATCCACCTTTTCTCTTTCATGGAGTCTGGGATTCTGCTGGCCATG
AGCTTTGATCGTTATGTAGCCATCTGTAACCCACTGAGGTATTCCACAGTGCTCACTGAT
GCCCGGGTGGTGTGGATGGGAGTGTGTGTTTTTCTTCGAAGTTTTTGCATGATTTTCCCA
TTACCTTTCCTTCTGAAGAGGTTGCCCTTCTGCAAGGCTAATGTGCTCTCCCATGCCTAC
TGTCTGCATCCAGACATGATTCGCCTACCCTGTGGTGATATTACCATTAATAATATATTT
GGCTTGTTCATAGTCATCTCTACCTTTGGGCTGGATTCAGCACTCATTCTCCTCTCTTAC
ATTCTCATACTTCGTTCCGTGCTTGCTATTGCCTCCAAGGAAGAAAGGCTGAAGACTCTG
AACACATGTGTGTCACACCTGTGTGCTGTGCTCATTTTCTATGTGCCCATGGTAGGCGTG
TCCATGGCTGCTCGCTATGGGAGGCATGCCCCACGCTATGTGCATACGCTCCTATCACTT
GTTTATCTGTTTGTGCCTCCAATGCTCAATCCTGTAATTTATTCTATCAAAACCAAGGAG
ATTCGCCGGAGGCTCTGCAAAATCCTGCTGGGGACCAAGATT


Conceptual translation

MRGEAQNSSGLPPFILTGLPGLETSQHWLFLLLGVLYTVSIVGNALILFIIKEEESLHQP
MYYFLSLLSVNDLGVSFSTLPTVLAVFCFHLREISFNSCMSQMFFIHLFSFMESGILLAM
SFDRYVAICNPLRYSTVLTDARVVWMGVCVFLRSFCMIFPLPFLLKRLPFCKANVLSHAY
CLHPDMIRLPCGDITINNIFGLFIVISTFGLDSALILLSYILILRSVLAIASKEERLKTL
NTCVSHLCAVLIFYVPMVGVSMAARYGRHAPRYVHTLLSLVYLFVPPMLNPVIYSIKTKE
IRRRLCKILLGTKI