Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51a5 Olfactory Receptor

Gene Symbol Or51a5
Organism Mouse
Family 51
Subfamily a
Pseudo No
Location chr7:103,122,000-103,123,000 (-)
Aliases Olfr586

Sequence information


Nucleotide sequence

MHTGMSIFNLSVTEVSTFHLVGFPGMESAHIWIFIPICLLYTVAILGNCTILFFIKSEPS
LHEPMYYFLSMLALSDLGLSISSLPTMLKVFLFNSPDISPNECFAQEFFIHEFSAMESSV
LLIMSFDRYIAICNPLRYTSILTSARVLQIGLAFSLKNVLLILPFPVTLVRLRYCKKNLL
SHSYCLHQDVMKLACSDNKFNVIYGLFVALTGILDITFIFMSYALILRAVLGIASQRERL
KVLSTCVSHICAVLIFYVPVISLAVIYRLASRSSPISKILMADIFLLVPPVMNPIIYCVK
SQQIRNVILEKLCQKQS


Conceptual translation

MHTGMSIFNLSVTEVSTFHLVGFPGMESAHIWIFIPICLLYTVAILGNCTILFFIKSEPS
LHEPMYYFLSMLALSDLGLSISSLPTMLKVFLFNSPDISPNECFAQEFFIHEFSAMESSV
LLIMSFDRYIAICNPLRYTSILTSARVLQIGLAFSLKNVLLILPFPVTLVRLRYCKKNLL
SHSYCLHQDVMKLACSDNKFNVIYGLFVALTGILDITFIFMSYALILRAVLGIASQRERL
KVLSTCVSHICAVLIFYVPVISLAVIYRLASRSSPISKILMADIFLLVPPVMNPIIYCVK
SQQIRNVILEKLCQKQS